| Assay Method Information | |
| | MASTL Activity Assay |
| Description: | Wild-type human active MASTL (154 pM) was incubated in assay buffer (50 mM HEPES, 100 mM NaCl, 0.1 mM EGTA, 10 mM MgCl2, 0.01% Tween-20, 0.5 mM TCEP, pH 7.5) with biotin tagged 40-mer ENSA peptide (10 nM), test compound and ATP (18 μM) for 60 minutes at room temperature. Test compounds were assayed using a 12-point dose range consisting of a 0, DMSO control and 10 sequential doses consisting from 0.0005, 0.002, 0.005, 0.014, 0.04, 0.12, 0.37, 1.11, 3.33 and 10 μM. The DMSO concentration was the same (1%) in all samples. An equal volume of detection buffer (assay buffer+267.5 pM Ab-K, 1.25 nM SA-D2, 20 mM EDTA and 400 mM KF) was added to stop the reaction to make a final volume of 20 μl, RT for 60 mins. Activity was measured using a plate reader (PerkinElmer EnSight) by the FRET signal generated between SA-D2 (streptavidin-D2) and Ab-K (anti-phospho-Serine 67 ENSA antibody (rabbit polyclonal, using standard techniques by a commercial supplier) conjugated to Cryptate). HTRF reagents (CisBio) were prepared as per the manufacturer recommendations. The 40-mer biotin-tagged ENSA peptide (synthesised by Bionics) used was based around Serine 67 on ENSA (YPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNK). |
| Affinity data for this assay | |
|---|---|
| If you find an error in this entry please send us an E-mail | |