Compile Data Set for Download or QSAR
Report error Found 205 Enz. Inhib. hit(s) with all data for entry = 50017511
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602423BDBM50602423(CHEMBL5197758)
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570070BDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602426BDBM50602426(CHEMBL5191228)
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602435BDBM50602435(CHEMBL5200095 | US11919896, Compound 1-7 | US12486...)
Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570070BDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 10nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570068BDBM570068(US11427581, Compound 3-3)
Affinity DataIC50: 12nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602440BDBM50602440(CHEMBL5201720 | US11919896, Compound 1-14 | US1241...)
Affinity DataIC50: 12nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602433BDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 14nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602439BDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 15nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570069BDBM570069(US11427581, Compound 3-4)
Affinity DataIC50: 17nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602439BDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 18nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602429BDBM50602429(CHEMBL5198580 | US11919896, Compound 3-8)
Affinity DataIC50: 20nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570060BDBM570060(US11427581, Compound 1-7)
Affinity DataIC50: 20nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602441BDBM50602441(CHEMBL5192867 | US11919896, Compound 1-15)
Affinity DataIC50: 20nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602423BDBM50602423(CHEMBL5197758)
Affinity DataIC50: 22nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570070BDBM570070(US11427581, Compound 4-2)
Affinity DataIC50: 23nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602423BDBM50602423(CHEMBL5197758)
Affinity DataIC50: 24nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602426BDBM50602426(CHEMBL5191228)
Affinity DataIC50: 26nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602429BDBM50602429(CHEMBL5198580 | US11919896, Compound 3-8)
Affinity DataIC50: 26nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602433BDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 27nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570071BDBM570071(US11427581, Compound 4-3)
Affinity DataIC50: 31nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602427BDBM50602427(CHEMBL5206101)
Affinity DataIC50: 31nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602434BDBM50602434(CHEMBL5180245 | US11919896, Compound 1-10 | US1241...)
Affinity DataIC50: 32nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 103727BDBM103727(US8563545, 1 | US10112907, Example 00033 | US10206...)
Affinity DataIC50: 33nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602438BDBM50602438(CHEMBL5203588 | US11919896, Compound 1-9 | US12419...)
Affinity DataIC50: 34nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 36nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 37nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602435BDBM50602435(CHEMBL5200095 | US11919896, Compound 1-7 | US12486...)
Affinity DataIC50: 38nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602426BDBM50602426(CHEMBL5191228)
Affinity DataIC50: 40nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602436BDBM50602436(CHEMBL5181588 | US11919896, Compound 1-12 | US1241...)
Affinity DataIC50: 45nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602422BDBM50602422(CHEMBL5187505)
Affinity DataIC50: 48nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602430BDBM50602430(CHEMBL5195430 | US11919896, Compound 3-9)
Affinity DataIC50: 54nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 60nMAssay Description:Inhibition of JAK1/TYK2 signalling in human whole blood assessed as inhibition of IFN-alpha stimulated STAT1 phosphorylation in CD4+ lymphocytes prei...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602435BDBM50602435(CHEMBL5200095 | US11919896, Compound 1-7 | US12486...)
Affinity DataIC50: 60nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602418BDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7 | US12419...)
Affinity DataIC50: 63nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602420BDBM50602420(CHEMBL5197776 | US11919896, Compound 7-7 | US12419...)
Affinity DataIC50: 63nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602443BDBM50602443(CHEMBL5206970 | US11919896, Compound 1-17 | US1241...)
Affinity DataIC50: 65nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602427BDBM50602427(CHEMBL5206101)
Affinity DataIC50: 67nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602431BDBM50602431(CHEMBL5179073)
Affinity DataIC50: 68nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570074BDBM570074(US11427581, Compound 6-1)
Affinity DataIC50: 70nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570069BDBM570069(US11427581, Compound 3-4)
Affinity DataIC50: 71nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570060BDBM570060(US11427581, Compound 1-7)
Affinity DataIC50: 73nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602428BDBM50602428(CHEMBL5187733)
Affinity DataIC50: 75nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 570068BDBM570068(US11427581, Compound 3-3)
Affinity DataIC50: 78nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602433BDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 78nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602429BDBM50602429(CHEMBL5198580 | US11919896, Compound 3-8)
Affinity DataIC50: 80nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602417BDBM50602417(CHEMBL5169563)
Affinity DataIC50: 90nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602441BDBM50602441(CHEMBL5192867 | US11919896, Compound 1-15)
Affinity DataIC50: 106nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 103727BDBM103727(US8563545, 1 | US10112907, Example 00033 | US10206...)
Affinity DataIC50: 113nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
Displayed 1 to 50 (of 205 total ) | Next | Last >>
Jump to: