Compile Data Set for Download or QSAR
Report error Found 36 Enz. Inhib. hit(s) with all data for entry = 50045050
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043385BDBM50043385(CHEMBL3355072)
Affinity DataIC50: 0.300nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043387BDBM50043387(CHEMBL3355074)
Affinity DataIC50: 0.400nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043384BDBM50043384(CHEMBL3355071)
Affinity DataIC50: 0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043382BDBM50043382(CHEMBL3355069)
Affinity DataIC50: 0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043383BDBM50043383(CHEMBL3355070)
Affinity DataIC50: 1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043389BDBM50043389(CHEMBL3352844)
Affinity DataIC50: 2nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043381BDBM50043381(CHEMBL3355068)
Affinity DataIC50: 9nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043381BDBM50043381(CHEMBL3355068)
Affinity DataIC50: 26nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043388BDBM50043388(CHEMBL3355075)
Affinity DataIC50: 29nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043387BDBM50043387(CHEMBL3355074)
Affinity DataIC50: 37nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043382BDBM50043382(CHEMBL3355069)
Affinity DataIC50: 40nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043401BDBM50043401(CHEMBL3355079)
Affinity DataIC50: 41nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043382BDBM50043382(CHEMBL3355069)
Affinity DataIC50: 44nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043402BDBM50043402(CHEMBL3355080)
Affinity DataIC50: 64nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043385BDBM50043385(CHEMBL3355072)
Affinity DataIC50: 80nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043384BDBM50043384(CHEMBL3355071)
Affinity DataIC50: 123nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043385BDBM50043385(CHEMBL3355072)
Affinity DataIC50: 130nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043385BDBM50043385(CHEMBL3355072)
Affinity DataIC50: 140nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 160nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043383BDBM50043383(CHEMBL3355070)
Affinity DataIC50: 327nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043390BDBM50043390(CHEMBL3355076)
Affinity DataIC50: 440nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043385BDBM50043385(CHEMBL3355072)
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043383BDBM50043383(CHEMBL3355070)
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043385BDBM50043385(CHEMBL3355072)
Affinity DataIC50: 1.50E+3nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043387BDBM50043387(CHEMBL3355074)
Affinity DataIC50: 1.60E+3nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043392BDBM50043392(CHEMBL3355078)
Affinity DataIC50: 2.10E+3nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043387BDBM50043387(CHEMBL3355074)
Affinity DataIC50: 4.30E+3nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043387BDBM50043387(CHEMBL3355074)
Affinity DataIC50: 4.40E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043391BDBM50043391(CHEMBL3355077)
Affinity DataIC50: 6.20E+3nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 6.50E+3nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043384BDBM50043384(CHEMBL3355071)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043387BDBM50043387(CHEMBL3355074)
Affinity DataIC50: 1.25E+4nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 1.40E+4nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 3.00E+4nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed