BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51109665	OCc1cc(=O)c(O)co1	InChI=1S/C6H6O4/c7-2-4-1-5(8)6(9)3-10-4/h1,3,7,9H,2H2	BEJNERDRQOWKJM-UHFFFAOYSA-N	50031467	5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE::5-Hydroxy-2-hydroxymethyl-pyran-4-one::CHEMBL287556::Kojic Acid::US10857082, Kojic acid::US9422261, Kojic acid::US9682910, kojic acid	Tyrosinase			 52000							ChEMBL	10.1021/acs.jmedchem.7b01745	10.7270/Q2V127DR	29634898			Ferro, S; Deri, B; Germanò, MP; Gitto, R; Ielo, L; Buemi, MR; Certo, G; Vittorio, S; Rapisarda, A; Pazy, Y; Fishman, A; De Luca, L	Universit� di Messina	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50031467	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007728&target=Tyrosinase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50031467&enzyme=Tyrosinase&column=ki&startPg=0&Increment=50&submit=Search	KOJ	5I38,5M8Q,5M8M,1GQH,3NQ1	3840	103940102	43572	CHEMBL287556	DB01759		C14516	ZINC13831818	1	MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS	3NM8,3NPY,3NQ0,3NQ1,3NTM,4D87,4P6R,4P6S,4P6T,5I38,5I3A,5I3B,5OAE,6EI4,6QXD						Tyrosinase	B2ZB02_PRIMG	B2ZB02		
51439525	OCc1cc(=O)c(O)co1	InChI=1S/C6H6O4/c7-2-4-1-5(8)6(9)3-10-4/h1,3,7,9H,2H2	BEJNERDRQOWKJM-UHFFFAOYSA-N	50031467	5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE::5-Hydroxy-2-hydroxymethyl-pyran-4-one::CHEMBL287556::Kojic Acid::US10857082, Kojic acid::US9422261, Kojic acid::US9682910, kojic acid	Tyrosinase				 377000						ChEMBL	10.1016/j.ejmech.2021.113850	10.7270/Q2BP06P2	34628235			Fu, D; Yuan, Y; Qin, F; Xu, Y; Cui, X; Li, G; Yao, S; Deng, Y; Tang, Z	University of Chinese Academy of Sciences	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50031467	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007728&target=Tyrosinase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50031467&enzyme=Tyrosinase&column=ki&startPg=0&Increment=50&submit=Search	KOJ	5I38,5M8Q,5M8M,1GQH,3NQ1	3840	103940102	43572	CHEMBL287556	DB01759		C14516	ZINC13831818	1	MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS	3NM8,3NPY,3NQ0,3NQ1,3NTM,4D87,4P6R,4P6S,4P6T,5I38,5I3A,5I3B,5OAE,6EI4,6QXD						Tyrosinase	B2ZB02_PRIMG	B2ZB02