BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50152259	CCCCCCCCCCCCCCC(N)CN(CC)CC	InChI=1S/C20H44N2/c1-4-7-8-9-10-11-12-13-14-15-16-17-18-20(21)19-22(5-2)6-3/h20H,4-19,21H2,1-3H3	UOERQNNPROAOGM-UHFFFAOYSA-N	50085496	CHEMBL89162::N*1*,N*1*-Diethyl-hexadecane-1,2-diamine::N1,N1-diethylhexadecane-1,2-diamine	1-alkyl-2-acetylglycerophosphocholine esterase			 3600							ChEMBL	10.1016/s0960-894x(99)00680-0	10.7270/Q2ZC8239	10698455			Lucas, R; Ubeda, A; Paya, M; Alves, M; del Olmo, E; Lopez, JL; San Feliciano, A	Univ. de Valencia	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50085496	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007232&target=1-alkyl-2-acetylglycerophosphocholine+esterase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50085496&enzyme=1-alkyl-2-acetylglycerophosphocholine+esterase&column=ki&startPg=0&Increment=50&submit=Search			10403265	103984949		CHEMBL89162				ZINC38311888	1	ARMRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATCFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA							Group VII phospholipase A2	Q6UB75_PIG	Q6UB75		
50152260	CCCCCCCCCCCCCCC(CO)NCC	InChI=1S/C18H39NO/c1-3-5-6-7-8-9-10-11-12-13-14-15-16-18(17-20)19-4-2/h18-20H,3-17H2,1-2H3	NBFXPOZVZVLLKA-UHFFFAOYSA-N	50085497	2-(ethylamino)hexadecan-1-ol::2-Ethylamino-hexadecan-1-ol::CHEMBL89206	1-alkyl-2-acetylglycerophosphocholine esterase			 1400							ChEMBL	10.1016/s0960-894x(99)00680-0	10.7270/Q2ZC8239	10698455			Lucas, R; Ubeda, A; Paya, M; Alves, M; del Olmo, E; Lopez, JL; San Feliciano, A	Univ. de Valencia	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50085497	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007232&target=1-alkyl-2-acetylglycerophosphocholine+esterase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50085497&enzyme=1-alkyl-2-acetylglycerophosphocholine+esterase&column=ki&startPg=0&Increment=50&submit=Search			10016808	103984950		CHEMBL89206				ZINC14127930	1	ARMRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATCFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA							Group VII phospholipase A2	Q6UB75_PIG	Q6UB75		
50559756	Cc1ccc(SCCCCC(CN)c2ccc(F)cc2)cc1	InChI=1S/C19H24FNS/c1-15-5-11-19(12-6-15)22-13-3-2-4-17(14-21)16-7-9-18(20)10-8-16/h5-12,17H,2-4,13-14,21H2,1H3	ZSKLAKZZOGGXRK-UHFFFAOYSA-N	50281622	2-(4-fluorophenyl)-6-(4-methylphenylsulfanyl)-1-hexanamine; with Hydrochloric acid::CHEMBL545590	1-alkyl-2-acetylglycerophosphocholine esterase			 4100							ChEMBL	10.1016/S0960-894X(01)81260-9	10.7270/Q2SJ1M3F				Wilkerson, W; DeLucca, I; Galbraith, W; Harris, R; Kerr, J	TBA	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50281622	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007232&target=1-alkyl-2-acetylglycerophosphocholine+esterase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50281622&enzyme=1-alkyl-2-acetylglycerophosphocholine+esterase&column=ki&startPg=0&Increment=50&submit=Search			44375473	104123296		CHEMBL545590				ZINC27843263	1	ARMRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATCFFKDQSAAEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA							Group VII phospholipase A2	Q6UB75_PIG	Q6UB75