BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50475100	C[C@H]1CC[C@H](N)CC1	InChI=1S/C7H15N/c1-6-2-4-7(8)5-3-6/h6-7H,2-5,8H2,1H3/t6-,7-	KSMVBYPXNKCPAJ-LJGSYFOKSA-N	50152094	CHEMBL3780789	Spermidine synthase			 1700							ChEMBL	10.1021/acs.jmedchem.5b01769	10.7270/Q2CV4KM8	26881725			Yamasaki, K; Tani, O; Tateishi, Y; Tanabe, E; Namatame, I; Niimi, T; Furukawa, K; Sakashita, H	National Institute of Advanced Industrial Science and Technology (AIST)	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50152094	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007062&target=Spermidine+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50152094&enzyme=Spermidine+synthase&column=ki&startPg=0&Increment=50&submit=Search	4JU		80604	340132908		CHEMBL3780789					1	LDLIKEMRQFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNPSTNFREPVQLLTQKQVEQRQLRYYNSDVHRAAFVLPEFARKALNDAD							Spermidine synthase	Q6QA75_PIG	Q6QA75		
50474705	COc1ccc(cc1OC)C1CC(=NN1c1nc(cs1)-c1ccc(cc1)N1C(=O)c2ccccc2C1=O)c1cccs1	InChI=1S/C32H24N4O4S2/c1-39-27-14-11-20(16-28(27)40-2)26-17-24(29-8-5-15-41-29)34-36(26)32-33-25(18-42-32)19-9-12-21(13-10-19)35-30(37)22-6-3-4-7-23(22)31(35)38/h3-16,18,26H,17H2,1-2H3	UOEGYWWWSHVNGP-UHFFFAOYSA-N	50151659	CHEMBL3775244	Spermidine synthase			 190000							ChEMBL	10.1021/acs.jmedchem.5b01502	10.7270/Q2DV1MRN	26701186			Simon, RP; Robaa, D; Alhalabi, Z; Sippl, W; Jung, M	University of Freiburg	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50151659	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50007062&target=Spermidine+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50151659&enzyme=Spermidine+synthase&column=ki&startPg=0&Increment=50&submit=Search			2854538	104039829		CHEMBL3775244				ZINC28380774	1	LDLIKEMRQFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNPSTNFREPVQLLTQKQVEQRQLRYYNSDVHRAAFVLPEFARKALNDAD							Spermidine synthase	Q6QA75_PIG	Q6QA75