BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50246391	O=C(Nc1nc2cccc(-c3ccc(CN4CCS(=O)(=O)CC4)cc3)n2n1)C1CC1	InChI=1S/C21H23N5O3S/c27-20(17-8-9-17)23-21-22-19-3-1-2-18(26(19)24-21)16-6-4-15(5-7-16)14-25-10-12-30(28,29)13-11-25/h1-7,17H,8-14H2,(H,23,24,27)	RIJLVEAXPNLDTC-UHFFFAOYSA-N	103727	US10112907, Example 00033::US10206907, Compound 200::US10708263, Compound 1::US10766894, Compound TABLE 1.18::US10919890, Compound 1::US10961228, Example Filgotinib::US11000528, Cpd # 1::US11203595, TABLE 1.18::US11279699, Compound Filgotinib::US8563545, 1	Jak1 protein			 29							ChEMBL	10.1021/jm501262q	10.7270/Q2GH9KK6	25369270			Menet, CJ; Fletcher, SR; Van Lommen, G; Geney, R; Blanc, J; Smits, K; Jouannigot, N; Deprez, P; van der Aar, EM; Clement-Lacroix, P; Lepescheux, L; Galien, R; Vayssiere, B; Nelles, L; Christophe, T; Brys, R; Uhring, M; Ciesielski, F; Van Rompaey, L	Galapagos NV	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=103727	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006724&target=Jak1+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=103727&enzyme=Jak1+protein&column=ki&startPg=0&Increment=50&submit=Search	2HB	5UT5,4P7E	49831257	172099018						ZINC96174616	1	MEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLSCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALLK	6C7Y						Jak1 protein	Q5FVF5_RAT	Q5FVF5