BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51070511	Cc1nc2NC(=O)OCc2c(C)c1O	InChI=1S/C9H10N2O3/c1-4-6-3-14-9(13)11-8(6)10-5(2)7(4)12/h12H,3H2,1-2H3,(H,10,11,13)	UYNZLQZOVOYPQD-UHFFFAOYSA-N	50437330	CHEMBL2407812	Myoglobin	Homo sapiens		 5300							ChEMBL	10.1021/ml4000904	10.7270/Q2DZ09PP	24482730			Shchepin, RV; Liu, W; Yin, H; Zagol-Ikapitte, I; Amin, T; Jeong, BS; Roberts, LJ; Oates, JA; Porter, NA; Boutaud, O	Vanderbilt University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437330	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006407&target=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437330&enzyme=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search			72165035	175449647		CHEMBL2407812				ZINC96273209	1	MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG	1MNH,1MNI,1MNJ,1MNK,3RGK,3WYO	Myoglobin	MYG_HUMAN	P02144	Q52H51 Q5THY7						
51070512	Cc1nc2NC(=O)NCc2c(C)c1O	InChI=1S/C9H11N3O2/c1-4-6-3-10-9(14)12-8(6)11-5(2)7(4)13/h13H,3H2,1-2H3,(H2,10,11,12,14)	XZTNTCYJBNABBM-UHFFFAOYSA-N	50437331	CHEMBL2407811	Myoglobin	Homo sapiens		 2300							ChEMBL	10.1021/ml4000904	10.7270/Q2DZ09PP	24482730			Shchepin, RV; Liu, W; Yin, H; Zagol-Ikapitte, I; Amin, T; Jeong, BS; Roberts, LJ; Oates, JA; Porter, NA; Boutaud, O	Vanderbilt University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437331	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006407&target=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437331&enzyme=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search			72164894	175449648		CHEMBL2407811				ZINC96273210	1	MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG	1MNH,1MNI,1MNJ,1MNK,3RGK,3WYO	Myoglobin	MYG_HUMAN	P02144	Q52H51 Q5THY7						
51070513	Oc1cnc2NC(=O)NCc2c1	InChI=1S/C7H7N3O2/c11-5-1-4-2-9-7(12)10-6(4)8-3-5/h1,3,11H,2H2,(H2,8,9,10,12)	NBWLMSCMBRTDMA-UHFFFAOYSA-N	50437332	CHEMBL2407813	Myoglobin	Homo sapiens		 1200							ChEMBL	10.1021/ml4000904	10.7270/Q2DZ09PP	24482730			Shchepin, RV; Liu, W; Yin, H; Zagol-Ikapitte, I; Amin, T; Jeong, BS; Roberts, LJ; Oates, JA; Porter, NA; Boutaud, O	Vanderbilt University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50437332	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006407&target=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50437332&enzyme=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search			72164893	175449649		CHEMBL2407813				ZINC96273211	1	MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG	1MNH,1MNI,1MNJ,1MNK,3RGK,3WYO	Myoglobin	MYG_HUMAN	P02144	Q52H51 Q5THY7						
51070514	CC(=O)Nc1ccc(O)cc1	InChI=1S/C8H9NO2/c1-6(10)9-7-2-4-8(11)5-3-7/h2-5,11H,1H3,(H,9,10)	RZVAJINKPMORJF-UHFFFAOYSA-N	26197	CHEMBL112::N-(4-hydroxyphenyl)acetamide::Norco::Paracetamol::US9333197, Acetaminophen::acetaminophen::phenol derivative, 11	Myoglobin	Homo sapiens		 2300							ChEMBL	10.1021/ml4000904	10.7270/Q2DZ09PP	24482730			Shchepin, RV; Liu, W; Yin, H; Zagol-Ikapitte, I; Amin, T; Jeong, BS; Roberts, LJ; Oates, JA; Porter, NA; Boutaud, O	Vanderbilt University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26197	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006407&target=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26197&enzyme=Myoglobin&column=ki&startPg=0&Increment=50&submit=Search	NNS	1TYL,1TYM,2DPZ,2OCU,3DJI	1983	56464634	46195	CHEMBL112	DB00316	5239	C06804	ZINC18274777	1	MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG	1MNH,1MNI,1MNJ,1MNK,3RGK,3WYO	Myoglobin	MYG_HUMAN	P02144	Q52H51 Q5THY7