BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51048987	CCNc1nc2CCN(Cc2c(n1)C(N)=O)C(=O)CCc1ccc(cc1)C(C)C	InChI=1S/C22H29N5O2/c1-4-24-22-25-18-11-12-27(13-17(18)20(26-22)21(23)29)19(28)10-7-15-5-8-16(9-6-15)14(2)3/h5-6,8-9,14H,4,7,10-13H2,1-3H3,(H2,23,29)(H,24,25,26)	BXJNYBTXBRHAEU-UHFFFAOYSA-N	50428095	CHEMBL2331646	G-protein coupled bile acid receptor 1	Rattus norvegicus				 3930					ChEMBL	10.1021/ml300277t	10.7270/Q2NP25R3	24900564			Piotrowski, DW; Futatsugi, K; Warmus, JS; Orr, ST; Freeman-Cook, KD; Londregan, AT; Wei, L; Jennings, SM; Herr, M; Coffey, SB; Jiao, W; Storer, G; Hepworth, D; Wang, J; Lavergne, SY; Chin, JE; Hadcock, JR; Brenner, MB; Wolford, AC; Janssen, AM; Roush, NS; Buxton, J; Hinchey, T; Kalgutkar, AS; Sharma, R; Flynn, DA	Pfizer Inc	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50428095	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006271&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50428095&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	FWX	7CFM	71541719	164156970		CHEMBL2331646				ZINC95588443	1	MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWISSLLFASLPALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHHQLREIRRLERAVCRDAPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPVTLLSLISLGSASAAVVPVAMGLGDQRYTAPWRTAAQRWLQVLRGRPKRANPGPSTAYHSSSQCSTDLDLN		G-protein coupled bile acid receptor 1	GPBAR_RAT	Q80T02							
51013097	CN(C(=O)c1c(C)onc1-c1ccccc1Cl)c1ccc(Cl)cc1	InChI=1S/C18H14Cl2N2O2/c1-11-16(17(21-24-11)14-5-3-4-6-15(14)20)18(23)22(2)13-9-7-12(19)8-10-13/h3-10H,1-2H3	IGRCWJPBLWGNPX-UHFFFAOYSA-N	50414954	CHEMBL575966	G-protein coupled bile acid receptor 1	Rattus norvegicus				 1995.26					ChEMBL	10.1021/jm901434t	10.7270/Q2Z89DPD	19902954			Evans, KA; Budzik, BW; Ross, SA; Wisnoski, DD; Jin, J; Rivero, RA; Vimal, M; Szewczyk, GR; Jayawickreme, C; Moncol, DL; Rimele, TJ; Armour, SL; Weaver, SP; Griffin, RJ; Tadepalli, SM; Jeune, MR; Shearer, TW; Chen, ZB; Chen, L; Anderson, DL; Becherer, JD; De Los Frailes, M; Colilla, FJ	GlaxoSmithKline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50414954	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006271&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50414954&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			44605616	163363978		CHEMBL575966				ZINC43208218	1	MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWISSLLFASLPALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHHQLREIRRLERAVCRDAPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPVTLLSLISLGSASAAVVPVAMGLGDQRYTAPWRTAAQRWLQVLRGRPKRANPGPSTAYHSSSQCSTDLDLN		G-protein coupled bile acid receptor 1	GPBAR_RAT	Q80T02							
51013113	CN(C(=O)c1c(C)onc1-c1ccccc1Cl)c1ccc(C)c(Cl)c1	InChI=1S/C19H16Cl2N2O2/c1-11-8-9-13(10-16(11)21)23(3)19(24)17-12(2)25-22-18(17)14-6-4-5-7-15(14)20/h4-10H,1-3H3	WRRGABWWSIAMMJ-UHFFFAOYSA-N	50414955	CHEMBL576138	G-protein coupled bile acid receptor 1	Rattus norvegicus				 630.96					ChEMBL	10.1021/jm901434t	10.7270/Q2Z89DPD	19902954			Evans, KA; Budzik, BW; Ross, SA; Wisnoski, DD; Jin, J; Rivero, RA; Vimal, M; Szewczyk, GR; Jayawickreme, C; Moncol, DL; Rimele, TJ; Armour, SL; Weaver, SP; Griffin, RJ; Tadepalli, SM; Jeune, MR; Shearer, TW; Chen, ZB; Chen, L; Anderson, DL; Becherer, JD; De Los Frailes, M; Colilla, FJ	GlaxoSmithKline	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50414955	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50006271&target=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50414955&enzyme=G-protein+coupled+bile+acid+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			44605617	163363979		CHEMBL576138				ZINC43208217	1	MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWISSLLFASLPALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHHQLREIRRLERAVCRDAPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPVTLLSLISLGSASAAVVPVAMGLGDQRYTAPWRTAAQRWLQVLRGRPKRANPGPSTAYHSSSQCSTDLDLN		G-protein coupled bile acid receptor 1	GPBAR_RAT	Q80T02