BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50414156	Clc1ccc2c3[nH]c(nc3c3ccccc3c2c1)-c1c(cccc1C#N)C#N	InChI=1S/C23H11ClN4/c24-15-8-9-18-19(10-15)16-6-1-2-7-17(16)21-22(18)28-23(27-21)20-13(11-25)4-3-5-14(20)12-26/h1-10H,(H,27,28)	BVFLHOOKHPFDCT-UHFFFAOYSA-N	50227631	2-(6-chloro-1H-phenanthro[9,10-d]imidazol-2-yl)isophthalonitrile::CHEMBL412099	Glutathione transferase	Sus scrofa		 0.900000							ChEMBL	10.1021/jm800197b	10.7270/Q27W6C0K	18459759			Friesen, RW; Mancini, JA	Merck Frosst Centre for Therapeutic Research	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50227631	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003827&target=Glutathione+transferase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50227631&enzyme=Glutathione+transferase&column=ki&startPg=0&Increment=50&submit=Search	4DZ	4YL0	16070041	104097494		CHEMBL412099				ZINC29136213	1	MPPPSLEMVSGQVLPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDAQRHGGLQYCRSDPDVERCLRAHRNDMETIYPFLFLGLVYSFLGPDPFVAWMHFLIFFLGRMVHTIAYLGKLRAPTRSLAYTLAQLPCASMALQIVWEAARHL	4YK5,5BQG,5BQH,5BQI,5K0I,5T36,5T37,5TL9,6VL4						glutathione transferase	Q2TJZ7_PIG	Q2TJZ7