BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50751746	OC[C@H]1OC([C@H](O)[C@@H]1O)N1C=CS(=O)C=C1O	InChI=1S/C9H13NO6S/c11-3-5-7(13)8(14)9(16-5)10-1-2-17(15)4-6(10)12/h1-2,4-5,7-9,11-14H,3H2/t5-,7-,8-,9?,17?/m1/s1	NMSAOXDWOOZDRV-KLPYYBCBSA-N	50367747	CHEMBL605231	Activation-induced cytidine deaminase	Rattus norvegicus	 330000								ChEMBL	10.1021/jm00403a015	10.7270/Q2WW7J8H	3165132			Marcus, TE; Gundy, A; Levenson, CH; Meyer, RB	Washington State University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50367747	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002705&target=Activation-induced+cytidine+deaminase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50367747&enzyme=Activation-induced+cytidine+deaminase&column=ki&startPg=0&Increment=50&submit=Search			91930264	160846849		CHEMBL605231				ZINC49792849	1	CYVVKRRDSATSFSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRILGL							Activation-induced cytidine deaminase	Q70AG6_RAT	Q70AG6		
