BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50832805	COc1cc(CC(=C)c2ccc3OC(C)(C)CCc3c2)cc(OC)c1OC	InChI=1S/C23H28O4/c1-15(11-16-12-20(24-4)22(26-6)21(13-16)25-5)17-7-8-19-18(14-17)9-10-23(2,3)27-19/h7-8,12-14H,1,9-11H2,2-6H3	YDNOOMPTRZAXFS-UHFFFAOYSA-N	50172374	2,2-Dimethyl-6-[1-(3,4,5-trimethoxy-benzyl)-vinyl]-chroman::CHEMBL197472	Cytochrome c oxidase subunit NDUFA4	Homo sapiens		 18							ChEMBL	10.1021/jm050524f	10.7270/Q2V988V1	16134928			Nicolaou, KC	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50172374	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002430&target=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50172374&enzyme=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search			10155894	104058457		CHEMBL197472				ZINC28525815	1	MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF	5Z62	Cytochrome c oxidase subunit NDUFA4	NDUA4_HUMAN	O00483	A4D109 Q6FHN5						
50832813	COc1cc(COC(=O)c2ccc3OC(C)(C)C=Cc3c2)cc(OC)c1OC	InChI=1S/C22H24O6/c1-22(2)9-8-15-12-16(6-7-17(15)28-22)21(23)27-13-14-10-18(24-3)20(26-5)19(11-14)25-4/h6-12H,13H2,1-5H3	KGQMIJVIIHJLMD-UHFFFAOYSA-N	50172381	2,2-Dimethyl-2H-chromene-6-carboxylic acid 3,4,5-trimethoxy-benzyl ester::CHEMBL370213	Cytochrome c oxidase subunit NDUFA4	Homo sapiens		 55							ChEMBL	10.1021/jm050524f	10.7270/Q2V988V1	16134928			Nicolaou, KC	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50172381	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002430&target=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50172381&enzyme=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search			10110559	104058461		CHEMBL370213				ZINC00594351	1	MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF	5Z62	Cytochrome c oxidase subunit NDUFA4	NDUA4_HUMAN	O00483	A4D109 Q6FHN5						
50832841	COc1cc(CC(=C)c2ccc3OC(C)(C)CCc3c2)cc(OC)c1OC	InChI=1S/C23H28O4/c1-15(11-16-12-20(24-4)22(26-6)21(13-16)25-5)17-7-8-19-18(14-17)9-10-23(2,3)27-19/h7-8,12-14H,1,9-11H2,2-6H3	YDNOOMPTRZAXFS-UHFFFAOYSA-N	50172374	2,2-Dimethyl-6-[1-(3,4,5-trimethoxy-benzyl)-vinyl]-chroman::CHEMBL197472	Cytochrome c oxidase subunit NDUFA4	Homo sapiens		 18							ChEMBL	10.1021/jm050524f	10.7270/Q2V988V1	16134928			Nicolaou, KC	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50172374	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002430&target=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50172374&enzyme=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search			10155894	104058457		CHEMBL197472				ZINC28525815	1	MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF	5Z62	Cytochrome c oxidase subunit NDUFA4	NDUA4_HUMAN	O00483	A4D109 Q6FHN5						
50832852	COc1cc(COC(=O)c2ccc3OC(C)(C)C=Cc3c2)cc(OC)c1OC	InChI=1S/C22H24O6/c1-22(2)9-8-15-12-16(6-7-17(15)28-22)21(23)27-13-14-10-18(24-3)20(26-5)19(11-14)25-4/h6-12H,13H2,1-5H3	KGQMIJVIIHJLMD-UHFFFAOYSA-N	50172381	2,2-Dimethyl-2H-chromene-6-carboxylic acid 3,4,5-trimethoxy-benzyl ester::CHEMBL370213	Cytochrome c oxidase subunit NDUFA4	Homo sapiens		 55							ChEMBL	10.1021/jm050524f	10.7270/Q2V988V1	16134928			Nicolaou, KC	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50172381	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50002430&target=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50172381&enzyme=Cytochrome+c+oxidase+subunit+NDUFA4&column=ki&startPg=0&Increment=50&submit=Search			10110559	104058461		CHEMBL370213				ZINC00594351	1	MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF	5Z62	Cytochrome c oxidase subunit NDUFA4	NDUA4_HUMAN	O00483	A4D109 Q6FHN5