BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51374015	ONC(=O)CCCCCCNC(=O)c1cnc(nc1)N(c1ccccc1)c1ccccc1	InChI=1S/C24H27N5O3/c30-22(28-32)15-9-1-2-10-16-25-23(31)19-17-26-24(27-18-19)29(20-11-5-3-6-12-20)21-13-7-4-8-14-21/h3-8,11-14,17-18,32H,1-2,9-10,15-16H2,(H,25,31)(H,28,30)	QGZYDVAGYRLSKP-UHFFFAOYSA-N	50439674	RICOLINOSTAT::US10858323, Compound 2::US11207431, Example E::US8609678, 2-(diphenylamino)-N-(7-(hydroxyamino)-7-oxoheptyl)pyrimidine-5-carboxamide [26]	Histone deacetylase 6			 90							ChEMBL	10.1016/j.ejmech.2020.112411	10.7270/Q2JH3QVS	32615502			Gawel, JM; Shouksmith, AE; Raouf, YS; Nawar, N; Toutah, K; Bukhari, S; Manaswiyoungkul, P; Olaoye, OO; Israelian, J; Radu, TB; Cabral, AD; Sina, D; Sedighi, A; de Araujo, ED; Gunning, PT	University of Toronto Mississauga	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50439674	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000923&target=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50439674&enzyme=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search	AH4		53340666	175451991						ZINC89630354	1	MDAVPDTKGSSGPPRGTPETKLIIHRFSRSLPT								N/A	F8W336		
51374016	ONC(=O)CCCCCCNC(=O)c1cnc(nc1)N(c1ccccc1)c1ccccc1Cl	InChI=1S/C24H26ClN5O3/c25-20-12-7-8-13-21(20)30(19-10-4-3-5-11-19)24-27-16-18(17-28-24)23(32)26-15-9-2-1-6-14-22(31)29-33/h3-5,7-8,10-13,16-17,33H,1-2,6,9,14-15H2,(H,26,32)(H,29,31)	VLIUIBXPEDFJRF-UHFFFAOYSA-N	110036	US8609678, 2-((2-chlorophenyl)(phenyl)amino)-N-(7-(hydroxyamino)-7-oxoheptyl)pyrimidine-5-carboxamide [89]	Histone deacetylase 6			 154							ChEMBL	10.1016/j.ejmech.2020.112411	10.7270/Q2JH3QVS	32615502			Gawel, JM; Shouksmith, AE; Raouf, YS; Nawar, N; Toutah, K; Bukhari, S; Manaswiyoungkul, P; Olaoye, OO; Israelian, J; Radu, TB; Cabral, AD; Sina, D; Sedighi, A; de Araujo, ED; Gunning, PT	University of Toronto Mississauga	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=110036	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000923&target=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=110036&enzyme=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search			53340426	186526906							1	MDAVPDTKGSSGPPRGTPETKLIIHRFSRSLPT								N/A	F8W336		
51374017	CC(C)(C)c1ccc(cc1)C(=O)Nc1ccc(cc1)C(=O)NO	InChI=1S/C18H20N2O3/c1-18(2,3)14-8-4-12(5-9-14)16(21)19-15-10-6-13(7-11-15)17(22)20-23/h4-11,23H,1-3H3,(H,19,21)(H,20,22)	FMOQHLZNJFXULZ-UHFFFAOYSA-N	50519457	CHEMBL4452620	Histone deacetylase 6			 269							ChEMBL	10.1016/j.ejmech.2020.112411	10.7270/Q2JH3QVS	32615502			Gawel, JM; Shouksmith, AE; Raouf, YS; Nawar, N; Toutah, K; Bukhari, S; Manaswiyoungkul, P; Olaoye, OO; Israelian, J; Radu, TB; Cabral, AD; Sina, D; Sedighi, A; de Araujo, ED; Gunning, PT	University of Toronto Mississauga	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50519457	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000923&target=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50519457&enzyme=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search			11688197	440728039							1	MDAVPDTKGSSGPPRGTPETKLIIHRFSRSLPT								N/A	F8W336		
51374018	ONC(=O)c1ccc(CNC(=O)c2c(F)c(F)c(F)c(F)c2F)cc1	InChI=1S/C15H9F5N2O3/c16-9-8(10(17)12(19)13(20)11(9)18)15(24)21-5-6-1-3-7(4-2-6)14(23)22-25/h1-4,25H,5H2,(H,21,24)(H,22,23)	KMHKOOKREYIIBC-UHFFFAOYSA-N	50555680	CHEMBL4784006	Histone deacetylase 6			 74							ChEMBL	10.1016/j.ejmech.2020.112411	10.7270/Q2JH3QVS	32615502			Gawel, JM; Shouksmith, AE; Raouf, YS; Nawar, N; Toutah, K; Bukhari, S; Manaswiyoungkul, P; Olaoye, OO; Israelian, J; Radu, TB; Cabral, AD; Sina, D; Sedighi, A; de Araujo, ED; Gunning, PT	University of Toronto Mississauga	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50555680	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000923&target=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50555680&enzyme=Histone+deacetylase+6&column=ki&startPg=0&Increment=50&submit=Search			155155878	461694448							1	MDAVPDTKGSSGPPRGTPETKLIIHRFSRSLPT								N/A	F8W336