BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50744741	CN1CC(c2ccc(O)c(O)c2)c2cccc(N)c2C1	InChI=1S/C16H18N2O2/c1-18-8-12(10-5-6-15(19)16(20)7-10)11-3-2-4-14(17)13(11)9-18/h2-7,12,19-20H,8-9,17H2,1H3	ODIYTWXTFQEXKZ-UHFFFAOYSA-N	50027797	4-(8-Amino-2-methyl-1,2,3,4-tetrahydro-isoquinolin-4-yl)-benzene-1,2-diol::CHEMBL119555	cAMP-regulated phosphoprotein 19	Rattus norvegicus				 2880					ChEMBL	10.1021/jm00367a006	10.7270/Q21J9BBG	6317860			Dandridge, PA; Kaiser, C; Brenner, M; Gaitanopoulos, D; Davis, LD; Webb, RL; Foley, JJ; Sarau, HM	TBA	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50027797	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000490&target=cAMP-regulated+phosphoprotein+19&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50027797&enzyme=cAMP-regulated+phosphoprotein+19&column=ki&startPg=0&Increment=50&submit=Search			194310	103937246		CHEMBL119555				ZINC27102844	1	MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG		cAMP-regulated phosphoprotein 19	ARP19_RAT	Q712U5							
50744743	CN1C[C@@H](c2ccc(O)c(O)c2)c2cccc(N)c2C1	InChI=1S/C16H18N2O2/c1-18-8-12(10-5-6-15(19)16(20)7-10)11-3-2-4-14(17)13(11)9-18/h2-7,12,19-20H,8-9,17H2,1H3/t12-/m0/s1	ODIYTWXTFQEXKZ-LBPRGKRZSA-N	50367174	CHEMBL1788237	cAMP-regulated phosphoprotein 19	Rattus norvegicus				 1870					ChEMBL	10.1021/jm00367a006	10.7270/Q21J9BBG	6317860			Dandridge, PA; Kaiser, C; Brenner, M; Gaitanopoulos, D; Davis, LD; Webb, RL; Foley, JJ; Sarau, HM	TBA	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50367174	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000490&target=cAMP-regulated+phosphoprotein+19&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50367174&enzyme=cAMP-regulated+phosphoprotein+19&column=ki&startPg=0&Increment=50&submit=Search			54580951	160846276		CHEMBL1788237				ZINC27102842	1	MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG		cAMP-regulated phosphoprotein 19	ARP19_RAT	Q712U5							
50744749	NCCc1ccc(O)c(O)c1	InChI=1S/C8H11NO2/c9-4-3-6-1-2-7(10)8(11)5-6/h1-2,5,10-11H,3-4,9H2	VYFYYTLLBUKUHU-UHFFFAOYSA-N	55121	3-HYDROXYTYRAMINE HYDROCHLORIDE::4-(2-aminoethyl)benzene-1,2-diol;hydrochloride::4-(2-aminoethyl)pyrocatechol;hydrochloride::4-(2-azanylethyl)benzene-1,2-diol;hydrochloride::Dopamine::MLS000069419::SMR000059081::cid_65340	cAMP-regulated phosphoprotein 19	Rattus norvegicus				 3500					ChEMBL	10.1021/jm00367a006	10.7270/Q21J9BBG	6317860			Dandridge, PA; Kaiser, C; Brenner, M; Gaitanopoulos, D; Davis, LD; Webb, RL; Foley, JJ; Sarau, HM	TBA	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=55121	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000490&target=cAMP-regulated+phosphoprotein+19&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=55121&enzyme=cAMP-regulated+phosphoprotein+19&column=ki&startPg=0&Increment=50&submit=Search	LDP		681	252635126	18243		DB00988		C03758	ZINC00033882	1	MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG		cAMP-regulated phosphoprotein 19	ARP19_RAT	Q712U5