BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51223301	OC(=O)c1cnc(Nc2ccc(cc2)-c2ccncc2)nc1O	InChI=1S/C16H12N4O3/c21-14-13(15(22)23)9-18-16(20-14)19-12-3-1-10(2-4-12)11-5-7-17-8-6-11/h1-9H,(H,22,23)(H2,18,19,20,21)	VIUKKXGXPZLNPQ-UHFFFAOYSA-N	50502707	CHEMBL4458954	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase			 23482							ChEMBL	10.1016/j.bmcl.2019.126660	10.7270/Q20C501R	31521478			Watkins, SM; Ghose, D; Blain, JM; Grote, DL; Luan, CH; Clare, M; Meganathan, R; Horn, JR; Hagen, TJ	Northern Illinois University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50502707	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000310&target=2-C-methyl-D-erythritol+2%2C4-cyclodiphosphate+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50502707&enzyme=2-C-methyl-D-erythritol+2%2C4-cyclodiphosphate+synthase&column=ki&startPg=0&Increment=50&submit=Search			89880296	440711292							1	MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK	3GHZ,3T80	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	ISPF_SALTY	Q8ZMF7							
51223302	CCOC(=O)C1=C(C)N=c2s\c(=C/c3cc(Br)c(O)c(Br)c3)c(=O)n2C1c1cccs1	InChI=1S/C21H16Br2N2O4S2/c1-3-29-20(28)16-10(2)24-21-25(17(16)14-5-4-6-30-14)19(27)15(31-21)9-11-7-12(22)18(26)13(23)8-11/h4-9,17,26H,3H2,1-2H3/b15-9-	PGQCIGAQWNRWBJ-DHDCSXOGSA-N	50502708	CHEMBL3222163	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase			 37012							ChEMBL	10.1016/j.bmcl.2019.126660	10.7270/Q20C501R	31521478			Watkins, SM; Ghose, D; Blain, JM; Grote, DL; Luan, CH; Clare, M; Meganathan, R; Horn, JR; Hagen, TJ	Northern Illinois University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50502708	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000310&target=2-C-methyl-D-erythritol+2%2C4-cyclodiphosphate+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50502708&enzyme=2-C-methyl-D-erythritol+2%2C4-cyclodiphosphate+synthase&column=ki&startPg=0&Increment=50&submit=Search			6281269	440711293							1	MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK	3GHZ,3T80	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	ISPF_SALTY	Q8ZMF7