BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
189440	Cc1cn(cn1)-c1cc(NC(=O)c2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)cc(c1)C(F)(F)F	InChI=1S/C28H22F3N7O/c1-17-5-6-19(10-25(17)37-27-33-9-7-24(36-27)20-4-3-8-32-14-20)26(39)35-22-11-21(28(29,30)31)12-23(13-22)38-15-18(2)34-16-38/h3-16H,1-2H3,(H,35,39)(H,33,36,37)	HHZIURLSWUIHRB-UHFFFAOYSA-N	50237710	4-methyl-N-[3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl]-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]benzamide::AMN 107::AMN107::CHEMBL255863::NILOTINIB::US11649218, Example Nilotinib	Ret proto-oncogene	Homo sapiens	 8678								PDSP Ki	10.1073/pnas.0511292103	10.7270/Q21Z430B	16492761			Melnick, JS; Janes, J; Kim, S; Chang, JY; Sipes, DG; Gunderson, D; Jarnes, L; Matzen, JT; Garcia, ME; Hood, TL; Beigi, R; Xia, G; Harig, RA; Asatryan, H; Yan, SF; Zhou, Y; Gu, XJ; Saadat, A; Zhou, V; King, FJ; Shaw, CM; Su, AI; Downs, R; Gray, NS; Schultz, PG; Warmuth, M; Caldwell, JS	Genomics Institute of the Novartis Research Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50237710	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000990&target=Ret+proto-oncogene&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50237710&enzyme=Ret+proto-oncogene&column=ki&startPg=0&Increment=50&submit=Search	NIL		644241	104056419	52172	CHEMBL255863	DB04868	5697		ZINC06716957	1	NASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQD							RET proto-oncogene tyrosine kinase receptor	Q9UE13_HUMAN	Q9UE13		
189441	CN1CCN(Cc2ccc(cc2)C(=O)Nc2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)CC1	InChI=1S/C29H31N7O/c1-21-5-10-25(18-27(21)34-29-31-13-11-26(33-29)24-4-3-12-30-19-24)32-28(37)23-8-6-22(7-9-23)20-36-16-14-35(2)15-17-36/h3-13,18-19H,14-17,20H2,1-2H3,(H,32,37)(H,31,33,34)	KTUFNOKKBVMGRW-UHFFFAOYSA-N	13530	4-[(4-methylpiperazin-1-yl)methyl]-N-[4-methyl-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]phenyl]benzamide::CHEMBL941::Gleevec::Imatinib::Imatinib, 21::N-(4-methyl-3-{[4-(pyridin-3-yl)pyrimidin-2-yl]amino}phenyl)-4-[(4-methylpiperazin-1-yl)methyl]benzamide::STI-571::STI571::US10906896, Cpd imatinib::US11649218, Example Imatinib::US9255107, Imatinib::cid_5291::imatinib-CD3::med.21724, Compound 6	Ret proto-oncogene	Homo sapiens	>10000								PDSP Ki	10.1073/pnas.0511292103	10.7270/Q21Z430B	16492761			Melnick, JS; Janes, J; Kim, S; Chang, JY; Sipes, DG; Gunderson, D; Jarnes, L; Matzen, JT; Garcia, ME; Hood, TL; Beigi, R; Xia, G; Harig, RA; Asatryan, H; Yan, SF; Zhou, Y; Gu, XJ; Saadat, A; Zhou, V; King, FJ; Shaw, CM; Su, AI; Downs, R; Gray, NS; Schultz, PG; Warmuth, M; Caldwell, JS	Genomics Institute of the Novartis Research Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=13530	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000990&target=Ret+proto-oncogene&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=13530&enzyme=Ret+proto-oncogene&column=ki&startPg=0&Increment=50&submit=Search	STI		5291	46513933	45783	CHEMBL941	DB00619	5687		ZINC19632618	1	NASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQD							RET proto-oncogene tyrosine kinase receptor	Q9UE13_HUMAN	Q9UE13