BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
174977	OC(Cn1c(CCCCCCC(O)=O)c(O)n(Cc2ccccc2)c1=O)C1CCCCC1	InChI=1S/C25H36N2O5/c28-22(20-13-7-4-8-14-20)18-26-21(15-9-1-2-10-16-23(29)30)24(31)27(25(26)32)17-19-11-5-3-6-12-19/h3,5-6,11-12,20,22,28,31H,1-2,4,7-10,13-18H2,(H,29,30)	ZTWOBAGECLBGCD-UHFFFAOYSA-N	85176	BW868C	Hematopoietic prostaglandin D synthase	Mus musculus	 220								PDSP Ki	10.1038/sj.bjp.0701367	10.7270/Q26M35CT	9313928			Kiriyama, M; Ushikubi, F; Kobayashi, T; Hirata, M; Sugimoto, Y; Narumiya, S	Kyoto University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=85176	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000946&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=85176&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search			91898929	136351276					C03491	ZINC89456120	1	MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL		Hematopoietic prostaglandin D synthase	HPGDS_MOUSE	Q9JHF7	Q14AR4 Q8CA80						
174978	CCCCCC(O)CC=C1C(CC=CCCCC(O)=O)C=CC1=O	InChI=1S/C20H30O4/c1-2-3-6-10-17(21)13-14-18-16(12-15-19(18)22)9-7-4-5-8-11-20(23)24/h4,7,12,14-17,21H,2-3,5-6,8-11,13H2,1H3,(H,23,24)	TUXFWOHFPFBNEJ-UHFFFAOYSA-N	82213	CAS_41598-07-6::NSC_114678::PGD2	Hematopoietic prostaglandin D synthase	Mus musculus	 21								PDSP Ki	10.1038/sj.bjp.0701367	10.7270/Q26M35CT	9313928			Kiriyama, M; Ushikubi, F; Kobayashi, T; Hirata, M; Sugimoto, Y; Narumiya, S	Kyoto University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=82213	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000946&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=82213&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search	PJ2	3A73	5353560	136350185						ZINC35050930	1	MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL		Hematopoietic prostaglandin D synthase	HPGDS_MOUSE	Q9JHF7	Q14AR4 Q8CA80						
174979	CCCCC[C@H](O)\C=C\C1C[C@H]2C[C@H](S2)[C@@H]1C\C=C/CCCC(O)=O	InChI=1S/C21H34O3S/c1-2-3-6-9-17(22)13-12-16-14-18-15-20(25-18)19(16)10-7-4-5-8-11-21(23)24/h4,7,12-13,16-20,22H,2-3,5-6,8-11,14-15H2,1H3,(H,23,24)/b7-4-,13-12+/t16?,17-,18-,19+,20-/m0/s1	OVGWMUWIRHGGJP-YUOWJYRGSA-N	81948	CAS_89617-02-7::ONO 11,113::ONO-11113::STA2	Hematopoietic prostaglandin D synthase	Mus musculus	 1600								PDSP Ki	10.1038/sj.bjp.0701367	10.7270/Q26M35CT	9313928			Kiriyama, M; Ushikubi, F; Kobayashi, T; Hirata, M; Sugimoto, Y; Narumiya, S	Kyoto University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=81948	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000946&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=81948&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search			6439867	131342522						ZINC33954698	1	MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL		Hematopoietic prostaglandin D synthase	HPGDS_MOUSE	Q9JHF7	Q14AR4 Q8CA80