BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
404394	Oc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O	InChI=1S/C15H10O7/c16-7-4-10(19)12-11(5-7)22-15(14(21)13(12)20)6-1-2-8(17)9(18)3-6/h1-5,16-19,21H	REFJWTPEDVJJIY-UHFFFAOYSA-N	7460	2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one::2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one::2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate::CHEMBL50::Quercetin::Quercetin (10)::Quercetin (21)::Quercetin (Qur)::US11021454, Compound Quercetin::US9180183, Quercetin::med.21724, Compound 4	Isoform A1-A of Heterogeneous nuclear ribonucleoprotein A1 (A1-A) 68-320]				 1.7e+3				4		Curated from the literature by BindingDB	10.1074/jbc.M114.553248	10.7270/Q26Q1W4N	24962584	aid1802891		Ko, CC; Chen, YJ; Chen, CT; Liu, YC; Cheng, FC; Hsu, KC; Chow, LP	National Taiwan University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=7460	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9928&target=Isoform+A1-A+of+Heterogeneous+nuclear+ribonucleoprotein+A1+%28A1-A%29+68-320%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=7460&enzyme=Isoform+A1-A+of+Heterogeneous+nuclear+ribonucleoprotein+A1+%28A1-A%29+68-320%5D&column=ki&startPg=0&Increment=50&submit=Search	QUE	3BPT,2HCK,3LJ0,4LMU,5FLI,5FLJ,3CF8,4DFU,4MRA,4WNJ,2O3P,2MS6,5AUW,3BXX,6M89,3LM5,1GP6,6AWS,6QCN,6QCD,7VUM,6B1D,2N6C,1E8W,2C9Z,5XG4,5A4V,2UXH,1H1I,2JJ2,6TTA,6IJD,3NVY	5280343	11108251	16243	CHEMBL50	DB04216	5346	C00389	ZINC03869685	1	NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF	7BX7,7ZJ2	Heterogeneous nuclear ribonucleoprotein A1	ROA1_HUMAN	P09651	A8K4Z8 Q3MIB7 Q6PJZ7						
