BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
397512	Cc1nnc2[C@H](CC(=O)OC(C)(C)C)N=C(c3c(C)c(C)sc3-n12)c1ccc(Cl)cc1	InChI=1S/C23H25ClN4O2S/c1-12-13(2)31-22-19(12)20(15-7-9-16(24)10-8-15)25-17(11-18(29)30-23(4,5)6)21-27-26-14(3)28(21)22/h7-10,17H,11H2,1-6H3/t17-/m0/s1	DNVXATUJJDPFDM-KRWDZBQOSA-N	50365262	(+)-JQ1::(S)-JQ1 (1)::CHEMBL1957266::JQ1::US10124009, Compound (S)-JQ1::US10202360, Example JQ-1::US10308662, Compound JQ-1::US10407441, Compound (S)-JQ1::US10617680, Example JQ-1::US10881668, Compound JQ1::US10925881, Name (S)-JQ1::US11020380, Example JQ-1::US11078188, Example (+)-JQ1::US11279703, TABLE 6.180::US11427593, Compound JQ1::US11466034, Example (+)-JQ1::US9320741, (S)-JQ1::US9695172, JQ1	Bromodomain-containing protein 4 [44-166,N140A]				 447.8				7.5	25.00 C	Curated from the literature by BindingDB	10.1074/jbc.M113.523019	10.7270/Q2VQ31JB	24497639	aid1802799		Jung, M; Philpott, M; Müller, S; Schulze, J; Badock, V; Eberspächer, U; Moosmayer, D; Bader, B; Schmees, N; Fernández-Montalván, A; Haendler, B	Bayer HealthCare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365262	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9764&target=Bromodomain-containing+protein+4+%5B44-166%2CN140A%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365262&enzyme=Bromodomain-containing+protein+4+%5B44-166%2CN140A%5D&column=ki&startPg=0&Increment=50&submit=Search			46907787	136969324		CHEMBL1957266				ZINC57318556	1	NPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYAKPGDDIVLMAEALEKLFLQKINELPT	4HBW,4UIX,5A5S,5WMD,5WMG,6BN8,6C7R,7X6T,8CKF	Bromodomain-containing protein 4	BRD4_HUMAN	O60885	O60433 Q4G0X8 Q86YS8 Q96PD3						
397523	Cc1nnc2[C@H](CC(=O)OC(C)(C)C)N=C(c3c(C)c(C)sc3-n12)c1ccc(Cl)cc1	InChI=1S/C23H25ClN4O2S/c1-12-13(2)31-22-19(12)20(15-7-9-16(24)10-8-15)25-17(11-18(29)30-23(4,5)6)21-27-26-14(3)28(21)22/h7-10,17H,11H2,1-6H3/t17-/m0/s1	DNVXATUJJDPFDM-KRWDZBQOSA-N	50365262	(+)-JQ1::(S)-JQ1 (1)::CHEMBL1957266::JQ1::US10124009, Compound (S)-JQ1::US10202360, Example JQ-1::US10308662, Compound JQ-1::US10407441, Compound (S)-JQ1::US10617680, Example JQ-1::US10881668, Compound JQ1::US10925881, Name (S)-JQ1::US11020380, Example JQ-1::US11078188, Example (+)-JQ1::US11279703, TABLE 6.180::US11427593, Compound JQ1::US11466034, Example (+)-JQ1::US9320741, (S)-JQ1::US9695172, JQ1	Bromodomain-containing protein 4 [44-166,N140A]				 8.6				7.5		Curated from the literature by BindingDB	10.1074/jbc.M113.523019	10.7270/Q2VQ31JB	24497639	aid1802797		Jung, M; Philpott, M; Müller, S; Schulze, J; Badock, V; Eberspächer, U; Moosmayer, D; Bader, B; Schmees, N; Fernández-Montalván, A; Haendler, B	Bayer HealthCare	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50365262	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9764&target=Bromodomain-containing+protein+4+%5B44-166%2CN140A%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50365262&enzyme=Bromodomain-containing+protein+4+%5B44-166%2CN140A%5D&column=ki&startPg=0&Increment=50&submit=Search			46907787	136969324		CHEMBL1957266				ZINC57318556	1	NPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYAKPGDDIVLMAEALEKLFLQKINELPT	4HBW,4UIX,5A5S,5WMD,5WMG,6BN8,6C7R,7X6T,8CKF	Bromodomain-containing protein 4	BRD4_HUMAN	O60885	O60433 Q4G0X8 Q86YS8 Q96PD3