BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
380950	N[C@@H](Cc1ccc(O)c(I)c1)C(O)=O	InChI=1S/C9H10INO3/c10-6-3-5(1-2-8(6)12)4-7(11)9(13)14/h1-3,7,12H,4,11H2,(H,13,14)/t7-/m0/s1	UQTZMGFTRHFAAM-ZETCQYMHSA-N	37633	(2S)-2-amino-3-(4-hydroxy-3-iodo-phenyl)propionic acid::(2S)-2-amino-3-(4-hydroxy-3-iodophenyl)propanoic acid::(2S)-2-azanyl-3-(3-iodanyl-4-oxidanyl-phenyl)propanoic acid::3-IODO-L-TYROSINE::3-Iodo-L-tyrosine (I-Tyr)::MLS000069664::Monoiodotyrosine::SMR000059143::cid_439744	Iodotyrosine deiodinase 1 [1-1,32-289]				 9e+1						Curated from the literature by BindingDB	10.1021/acs.biochem.6b01308	10.7270/Q2ZK5FJM	28157283	aid1802488		Ingavat, N; Kavran, JM; Sun, Z; Rokita, SE	Johns Hopkins University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=37633	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9155&target=Iodotyrosine+deiodinase+1+%5B1-1%2C32-289%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=37633&enzyme=Iodotyrosine+deiodinase+1+%5B1-1%2C32-289%5D&column=ki&startPg=0&Increment=50&submit=Search	IYR	1CF0,3TNZ,2D8P,2Z11,1WQ3,2ZP1,4EBK,3GFD,5KO8,2ZXV,2D8W,2R1Q,6TYK,3VN3,4TVD,4TVC,5EHB,5V7F,2Z10,5EMS,2D98,2D97,1XXZ,4IKM,4TTC,4TTU,2D8O,1XY9,6JQA,6D0Y,6Q1L	439744	252618601	27847		DB01758		C02515	ZINC00001575	1	MGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV	4TTB,4TTC	Iodotyrosine deiodinase 1	IYD1_HUMAN	Q6PHW0	C9JFW2 Q2VPW0 Q2VPW1 Q5F1L5 Q5F1L6 Q5THM4 Q6ZP69 Q7Z7D7 Q7Z7D8						
380951	Oc1ccccc1I	InChI=1S/C6H5IO/c7-5-3-1-2-4-6(5)8/h1-4,8H	KQDJTBPASNJQFQ-UHFFFAOYSA-N	217397	2-Iodophenol (2IP)	Iodotyrosine deiodinase 1 [1-1,32-289]				 1.410e+6						Curated from the literature by BindingDB	10.1021/acs.biochem.6b01308	10.7270/Q2ZK5FJM	28157283	aid1802488		Ingavat, N; Kavran, JM; Sun, Z; Rokita, SE	Johns Hopkins University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=217397	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=9155&target=Iodotyrosine+deiodinase+1+%5B1-1%2C32-289%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=217397&enzyme=Iodotyrosine+deiodinase+1+%5B1-1%2C32-289%5D&column=ki&startPg=0&Increment=50&submit=Search	6X8	5KRD	10784	329969006					C01874		1	MGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV	4TTB,4TTC	Iodotyrosine deiodinase 1	IYD1_HUMAN	Q6PHW0	C9JFW2 Q2VPW0 Q2VPW1 Q5F1L5 Q5F1L6 Q5THM4 Q6ZP69 Q7Z7D7 Q7Z7D8