BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
308832	Clc1oc(=O)c2ccccc2c1Cl	InChI=1S/C9H4Cl2O2/c10-7-5-3-1-2-4-6(5)9(12)13-8(7)11/h1-4H	SUGXUUGGLDCZKB-UHFFFAOYSA-N	50199883	3,4‐Dichloroisocoumarin (2)::3,4-Dichloro-isochromen-1-one::3,4-dichloro-1H-isochromen-1-one::3,4-dichloroisocoumarin::CHEMBL24983::cid_1609	Rhomboid domain-containing protein			 1.1e+3					7.4	37.00 C	Curated from the literature by BindingDB	10.1021/acschembio.5b00514	10.7270/Q2668BZ8	26218717	aid1801342		Wolf, EV; Zeissler, A; Verhelst, SH	Technische Universität München	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50199883	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7389&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50199883&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search	DIC		1609	104080348		CHEMBL24983	DB04459			ZINC00388510	1	MIPIKDVNPSRTFPIVNLSIIVACSLIWLYEWSLTDEVIYTFQGAVTKFELFLREWGLVPVELPQKPYTLLTHMFLHGSWGHIIGNMWFLWVFGDNVEDKLGKFRYIIFYILCGLGAALTQTFISLAFGGANVPMVGASGAISGVLGAYMKMFPHARVLALVPVFIFLTLMELPAVIFIGLWFFIQIINGIITLPFIGYGGVAWYAHIGGFITGYLLVDYFRKRSYS							Peptidase S54 rhomboid domain-containing protein	O67346_AQUAE	O67346		
308843	[O-][N+](=O)c1ccc2c(Cl)c(OCCCCCc3ccccc3)oc(=O)c2c1	InChI=1S/C20H18ClNO5/c21-18-16-11-10-15(22(24)25)13-17(16)19(23)27-20(18)26-12-6-2-5-9-14-7-3-1-4-8-14/h1,3-4,7-8,10-11,13H,2,5-6,9,12H2	VKSNRCDTOIDGQI-UHFFFAOYSA-N	165194	4‐Chloro‐7‐nitro‐3‐[(5‐phenylpentyl)oxy]isochromen‐1‐one (21)	Rhomboid domain-containing protein			 1.7e+3					7.4	37.00 C	Curated from the literature by BindingDB	10.1021/acschembio.5b00514	10.7270/Q2668BZ8	26218717	aid1801342		Wolf, EV; Zeissler, A; Verhelst, SH	Technische Universität München	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=165194	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=7389&target=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=165194&enzyme=Rhomboid+domain-containing+protein&column=ki&startPg=0&Increment=50&submit=Search			118009867	311420154							1	MIPIKDVNPSRTFPIVNLSIIVACSLIWLYEWSLTDEVIYTFQGAVTKFELFLREWGLVPVELPQKPYTLLTHMFLHGSWGHIIGNMWFLWVFGDNVEDKLGKFRYIIFYILCGLGAALTQTFISLAFGGANVPMVGASGAISGVLGAYMKMFPHARVLALVPVFIFLTLMELPAVIFIGLWFFIQIINGIITLPFIGYGGVAWYAHIGGFITGYLLVDYFRKRSYS							Peptidase S54 rhomboid domain-containing protein	O67346_AQUAE	O67346