BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
247009	CC(C)CCCC(C)CCCC(C)CCCC(C)CC(O)=O	InChI=1S/C20H40O2/c1-16(2)9-6-10-17(3)11-7-12-18(4)13-8-14-19(5)15-20(21)22/h16-19H,6-15H2,1-5H3,(H,21,22)	RLCKHJSFHOZMDR-UHFFFAOYSA-N	119875	3,7,11,15-tetramethylhexadecanoic acid::Phytanic acid	Fatty acid-binding protein, liver [T94A]	Homo sapiens	 38								Curated from the literature by BindingDB	10.1021/bi401014k	10.7270/Q2FB51MG	24299557	aid1800412		Martin, GG; McIntosh, AL; Huang, H; Gupta, S; Atshaves, BP; Landrock, KK; Landrock, D; Kier, AB; Schroeder, F	Texas A&M University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=119875	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6129&target=Fatty+acid-binding+protein%2C+liver+%5BT94A%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=119875&enzyme=Fatty+acid-binding+protein%2C+liver+%5BT94A%5D&column=ki&startPg=0&Increment=50&submit=Search	VGJ	2WM4	26840	220230669	16285				C01607		1	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTAFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI		Fatty acid-binding protein, liver	FABPL_HUMAN	P07148							
247010	CC(C)OC(=O)C(C)(C)Oc1ccc(cc1)C(=O)c1ccc(Cl)cc1	InChI=1S/C20H21ClO4/c1-13(2)24-19(23)20(3,4)25-17-11-7-15(8-12-17)18(22)14-5-9-16(21)10-6-14/h5-13H,1-4H3	YMTINGFKWWXKFG-UHFFFAOYSA-N	50085042	2-(4-(4-Chlorobenzoyl)phenoxy)-2-methylpropanoic acid 1-methylethyl ester::CHEMBL672::FENOFIBRATE::FNF::Fenofibric acid::Finofibrate::Isopropyl (4'-(p-chlorobenzoyl)-2-phenoxy-2-methyl)propionate::Isopropyl 2-(4-(4-chlorobenzoyl)phenoxy)-2-methylpropionate::Lipantil (TN)::Procetofen::Tricor (TN)::propan-2-yl 2-[4-(4-chlorobenzoyl)phenoxy]-2-methylpropanoate	Fatty acid-binding protein, liver [T94A]	Homo sapiens	 15								Curated from the literature by BindingDB	10.1021/bi401014k	10.7270/Q2FB51MG	24299557	aid1800412		Martin, GG; McIntosh, AL; Huang, H; Gupta, S; Atshaves, BP; Landrock, KK; Landrock, D; Kier, AB; Schroeder, F	Texas A&M University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50085042	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6129&target=Fatty+acid-binding+protein%2C+liver+%5BT94A%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50085042&enzyme=Fatty+acid-binding+protein%2C+liver+%5BT94A%5D&column=ki&startPg=0&Increment=50&submit=Search			3339	103984525	5001	CHEMBL672	DB01039	7186	C07586	ZINC00584092	1	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTAFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI		Fatty acid-binding protein, liver	FABPL_HUMAN	P07148							
247011	CC(C)(Oc1ccc(cc1)C(=O)c1ccc(Cl)cc1)C(O)=O	InChI=1S/C17H15ClO4/c1-17(2,16(20)21)22-14-9-5-12(6-10-14)15(19)11-3-7-13(18)8-4-11/h3-10H,1-2H3,(H,20,21)	MQOBSOSZFYZQOK-UHFFFAOYSA-N	28700	2-(4-(4-Chlorobenzoyl)phenoxy)-2-methylpropionic acid::2-{4-[(4-chlorophenyl)carbonyl]phenoxy}-2-methylpropanoic acid::CHEMBL981::FENOFIBRIC ACID::FIBRICOR::Fenofibrate::LF 153::alpha-1081::procetofenic acid	Fatty acid-binding protein, liver [T94A]	Homo sapiens	 3.1e+2								Curated from the literature by BindingDB	10.1021/bi401014k	10.7270/Q2FB51MG	24299557	aid1800412		Martin, GG; McIntosh, AL; Huang, H; Gupta, S; Atshaves, BP; Landrock, KK; Landrock, D; Kier, AB; Schroeder, F	Texas A&M University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=28700	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=6129&target=Fatty+acid-binding+protein%2C+liver+%5BT94A%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=28700&enzyme=Fatty+acid-binding+protein%2C+liver+%5BT94A%5D&column=ki&startPg=0&Increment=50&submit=Search	F5A	7WGP,6LX4,7BQ0,6L36	64929	58097888		CHEMBL981		2662		ZINC00001984	1	MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTAFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI		Fatty acid-binding protein, liver	FABPL_HUMAN	P07148