BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
200325	CC(=O)O[C@@H]1C[C@H]2C(C)(C)C(=O)C=C[C@]2(C)[C@H]2CC[C@@]3(C)[C@@H](C(=O)[C@H]4O[C@@]34[C@]12C)c1ccoc1	InChI=1S/C28H34O6/c1-15(29)33-20-13-18-24(2,3)19(30)8-10-25(18,4)17-7-11-26(5)21(16-9-12-32-14-16)22(31)23-28(26,34-23)27(17,20)6/h8-10,12,14,17-18,20-21,23H,7,11,13H2,1-6H3/t17-,18+,20-,21-,23-,25-,26+,27+,28-/m1/s1	NEYCGDYQBQONFC-GGPFZBFUSA-N	92409	Epoxyazadiradione	Macrophage migration inhibitory factor-like protein			 9.8e+3							Curated from the literature by BindingDB	10.1074/jbc.M112.341321	10.7270/Q2RV0M83	22645149	aid1799767		Alam, A; Haldar, S; Thulasiram, HV; Kumar, R; Goyal, M; Iqbal, MS; Pal, C; Dey, S; Bindu, S; Sarkar, S; Pal, U; Maiti, NC; Bandyopadhyay, U	Council of Scientific and Industrial Research (CSIR) Indian Institute of Chemical Biology	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=92409	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5136&target=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=92409&enzyme=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search			49863985	160844906	67285					ZINC58576553	1	MPCCELITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCSAQNFAFSGSLFG	2WKB,3GAC,3GAD						Macrophage migration inhibitory factor-like protein	Q1HEA2_PLAYO	Q1HEA2		
200326	CC(=O)O[C@@H]1C[C@H]2C(C)(C)C(=O)C=C[C@]2(C)[C@H]2CC[C@@]3(C)[C@@H](C(=O)C=C3[C@]12C)c1ccoc1	InChI=1S/C28H34O5/c1-16(29)33-23-14-20-25(2,3)22(31)8-11-26(20,4)19-7-10-27(5)21(28(19,23)6)13-18(30)24(27)17-9-12-32-15-17/h8-9,11-13,15,19-20,23-24H,7,10,14H2,1-6H3/t19-,20+,23-,24-,26-,27-,28-/m1/s1	KWAMDQVQFVBEAU-HMWIRDDCSA-N	92410	Azadiradione	Macrophage migration inhibitory factor-like protein			 4.30e+4							Curated from the literature by BindingDB	10.1074/jbc.M112.341321	10.7270/Q2RV0M83	22645149	aid1799767		Alam, A; Haldar, S; Thulasiram, HV; Kumar, R; Goyal, M; Iqbal, MS; Pal, C; Dey, S; Bindu, S; Sarkar, S; Pal, U; Maiti, NC; Bandyopadhyay, U	Council of Scientific and Industrial Research (CSIR) Indian Institute of Chemical Biology	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=92410	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5136&target=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=92410&enzyme=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search			12308714	160844907	67280					ZINC31495483	1	MPCCELITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCSAQNFAFSGSLFG	2WKB,3GAC,3GAD						Macrophage migration inhibitory factor-like protein	Q1HEA2_PLAYO	Q1HEA2		
200327	COC(=O)C[C@H]1[C@@]2(C)[C@H](O[C@@H]3C[C@H](C(C)=C23)c2ccoc2)[C@@H]2OC[C@@]3(C)[C@H]2[C@]1(C)[C@H](C[C@H]3OC(C)=O)OC(=O)C(\C)=C\C	InChI=1S/C34H44O9/c1-9-17(2)31(37)43-25-14-24(41-19(4)35)32(5)16-40-28-29(32)33(25,6)23(13-26(36)38-8)34(7)27-18(3)21(20-10-11-39-15-20)12-22(27)42-30(28)34/h9-11,15,21-25,28-30H,12-14,16H2,1-8H3/b17-9+/t21-,22-,23-,24-,25+,28-,29+,30-,32-,33+,34-/m1/s1	CJHBVBNPNXOWBA-REXVOHEDSA-N	92411	Salannin	Macrophage migration inhibitory factor-like protein			 9.52e+4							Curated from the literature by BindingDB	10.1074/jbc.M112.341321	10.7270/Q2RV0M83	22645149	aid1799767		Alam, A; Haldar, S; Thulasiram, HV; Kumar, R; Goyal, M; Iqbal, MS; Pal, C; Dey, S; Bindu, S; Sarkar, S; Pal, U; Maiti, NC; Bandyopadhyay, U	Council of Scientific and Industrial Research (CSIR) Indian Institute of Chemical Biology	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=92411	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5136&target=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=92411&enzyme=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search			6437066	160844908	67309					ZINC38139642	1	MPCCELITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCSAQNFAFSGSLFG	2WKB,3GAC,3GAD						Macrophage migration inhibitory factor-like protein	Q1HEA2_PLAYO	Q1HEA2		
200328	COC(=O)C[C@H]1[C@@]2(C)[C@H](O[C@@H]3C[C@H](C(C)=C23)c2ccoc2)[C@H](OC(C)=O)[C@H]2[C@@](C)(C=CC(=O)[C@]12C)C(=O)OC	InChI=1S/C30H36O9/c1-15-18(17-9-11-37-14-17)12-19-23(15)30(5)20(13-22(33)35-6)29(4)21(32)8-10-28(3,27(34)36-7)25(29)24(26(30)39-19)38-16(2)31/h8-11,14,18-20,24-26H,12-13H2,1-7H3/t18-,19-,20-,24-,25+,26-,28-,29+,30-/m1/s1	NHOIBRJOQAYBJT-IMGVWCFESA-N	92412	Nimbin	Macrophage migration inhibitory factor-like protein			 2.24e+4							Curated from the literature by BindingDB	10.1074/jbc.M112.341321	10.7270/Q2RV0M83	22645149	aid1799767		Alam, A; Haldar, S; Thulasiram, HV; Kumar, R; Goyal, M; Iqbal, MS; Pal, C; Dey, S; Bindu, S; Sarkar, S; Pal, U; Maiti, NC; Bandyopadhyay, U	Council of Scientific and Industrial Research (CSIR) Indian Institute of Chemical Biology	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=92412	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5136&target=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=92412&enzyme=Macrophage+migration+inhibitory+factor-like+protein&column=ki&startPg=0&Increment=50&submit=Search			108058	160844909	67304					ZINC08382508	1	MPCCELITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCSAQNFAFSGSLFG	2WKB,3GAC,3GAD						Macrophage migration inhibitory factor-like protein	Q1HEA2_PLAYO	Q1HEA2