BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
58523	CN[C@@H](C)C(=O)N[C@@H](C1CCOCC1)C(=O)N1CCC[C@H]1c1nc2c(nccc2s1)-c1ccccc1Cl	InChI=1S/C27H32ClN5O3S/c1-16(29-2)25(34)31-22(17-10-14-36-15-11-17)27(35)33-13-5-8-20(33)26-32-24-21(37-26)9-12-30-23(24)18-6-3-4-7-19(18)28/h3-4,6-7,9,12,16-17,20,22,29H,5,8,10-11,13-15H2,1-2H3,(H,31,34)/t16-,20-,22-/m0/s1	AVQIBLHJFPCFMB-BUKVSMQUSA-N	32576	PS-1	Baculoviral IAP repeat-containing protein 2 [269-336]	Homo sapiens	 36						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb900083m	10.7270/Q2DJ5D0Q	19492850	aid1799213		Ndubaku, C; Varfolomeev, E; Wang, L; Zobel, K; Lau, K; Elliott, LO; Maurer, B; Fedorova, AV; Dynek, JN; Koehler, M; Hymowitz, SG; Tsui, V; Deshayes, K; Fairbrother, WJ; Flygare, JA; Vucic, D	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=32576	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4022&target=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=32576&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search			44237038	85256443						ZINC70706481	1	HAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFL	7TRL,7TRM	Baculoviral IAP repeat-containing protein 2	BIRC2_HUMAN	Q13490	B4E026 Q16516 Q4TTG0						
58524	CN[C@H](C)C(=O)N[C@H](C1CCOCC1)C(=O)N1CCC[C@@H]1c1nc2c(nccc2s1)-c1ccccc1Cl	InChI=1S/C27H32ClN5O3S/c1-16(29-2)25(34)31-22(17-10-14-36-15-11-17)27(35)33-13-5-8-20(33)26-32-24-21(37-26)9-12-30-23(24)18-6-3-4-7-19(18)28/h3-4,6-7,9,12,16-17,20,22,29H,5,8,10-11,13-15H2,1-2H3,(H,31,34)/t16-,20-,22-/m1/s1	AVQIBLHJFPCFMB-BSLALVQMSA-N	32577	ent-PS-1	Baculoviral IAP repeat-containing protein 2 [269-336]	Homo sapiens	>34000						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb900083m	10.7270/Q2DJ5D0Q	19492850	aid1799213		Ndubaku, C; Varfolomeev, E; Wang, L; Zobel, K; Lau, K; Elliott, LO; Maurer, B; Fedorova, AV; Dynek, JN; Koehler, M; Hymowitz, SG; Tsui, V; Deshayes, K; Fairbrother, WJ; Flygare, JA; Vucic, D	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=32577	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4022&target=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=32577&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search			44237039	85256444						ZINC70706489	1	HAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFL	7TRL,7TRM	Baculoviral IAP repeat-containing protein 2	BIRC2_HUMAN	Q13490	B4E026 Q16516 Q4TTG0						
58525	CN[C@@H](C)C(=O)N[C@@H](C1CCCCC1)C(=O)N1CC[C@H](C)[C@H]1C(=O)Nc1cc(C)nn1-c1ccccc1	InChI=1S/C28H40N6O3/c1-18-15-16-33(28(37)24(21-11-7-5-8-12-21)31-26(35)20(3)29-4)25(18)27(36)30-23-17-19(2)32-34(23)22-13-9-6-10-14-22/h6,9-10,13-14,17-18,20-21,24-25,29H,5,7-8,11-12,15-16H2,1-4H3,(H,30,36)(H,31,35)/t18-,20-,24-,25-/m0/s1	IBBHIZXRMBKKII-IYNDAXALSA-N	32578	CS-1	Baculoviral IAP repeat-containing protein 2 [269-336]	Homo sapiens	 10						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb900083m	10.7270/Q2DJ5D0Q	19492850	aid1799213		Ndubaku, C; Varfolomeev, E; Wang, L; Zobel, K; Lau, K; Elliott, LO; Maurer, B; Fedorova, AV; Dynek, JN; Koehler, M; Hymowitz, SG; Tsui, V; Deshayes, K; Fairbrother, WJ; Flygare, JA; Vucic, D	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=32578	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4022&target=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=32578&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search			44237040	85256445						ZINC70706495	1	HAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFL	7TRL,7TRM	Baculoviral IAP repeat-containing protein 2	BIRC2_HUMAN	Q13490	B4E026 Q16516 Q4TTG0						
58526	CN[C@@H](C)C(=O)N[C@@H](C1CCCCC1)C(=O)N1CCC[C@H]1C(=O)Nc1ccccc1-c1ncccn1	InChI=1S/C27H36N6O3/c1-18(28-2)25(34)32-23(19-10-4-3-5-11-19)27(36)33-17-8-14-22(33)26(35)31-21-13-7-6-12-20(21)24-29-15-9-16-30-24/h6-7,9,12-13,15-16,18-19,22-23,28H,3-5,8,10-11,14,17H2,1-2H3,(H,31,35)(H,32,34)/t18-,22-,23-/m0/s1	JVEUWDBVAHOBCS-TZYHBYERSA-N	32579	CS-2	Baculoviral IAP repeat-containing protein 2 [269-336]	Homo sapiens	 37						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb900083m	10.7270/Q2DJ5D0Q	19492850	aid1799213		Ndubaku, C; Varfolomeev, E; Wang, L; Zobel, K; Lau, K; Elliott, LO; Maurer, B; Fedorova, AV; Dynek, JN; Koehler, M; Hymowitz, SG; Tsui, V; Deshayes, K; Fairbrother, WJ; Flygare, JA; Vucic, D	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=32579	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4022&target=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=32579&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search			44237041	85256446						ZINC62241991	1	HAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFL	7TRL,7TRM	Baculoviral IAP repeat-containing protein 2	BIRC2_HUMAN	Q13490	B4E026 Q16516 Q4TTG0						
58527	CN[C@@H](C)C(=O)N[C@@H](C1CCCCC1)C(=O)N1CC[C@H](C)[C@H]1C(=O)Nc1ccccc1-c1ncccn1	InChI=1S/C28H38N6O3/c1-18-14-17-34(28(37)23(20-10-5-4-6-11-20)33-26(35)19(2)29-3)24(18)27(36)32-22-13-8-7-12-21(22)25-30-15-9-16-31-25/h7-9,12-13,15-16,18-20,23-24,29H,4-6,10-11,14,17H2,1-3H3,(H,32,36)(H,33,35)/t18-,19-,23-,24-/m0/s1	HNXBUVYVPBCESY-WJNSRDFLSA-N	32580	CS-3	Baculoviral IAP repeat-containing protein 2 [269-336]	Homo sapiens	 16						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb900083m	10.7270/Q2DJ5D0Q	19492850	aid1799213		Ndubaku, C; Varfolomeev, E; Wang, L; Zobel, K; Lau, K; Elliott, LO; Maurer, B; Fedorova, AV; Dynek, JN; Koehler, M; Hymowitz, SG; Tsui, V; Deshayes, K; Fairbrother, WJ; Flygare, JA; Vucic, D	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=32580	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=4022&target=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=32580&enzyme=Baculoviral+IAP+repeat-containing+protein+2+%5B269-336%5D&column=ki&startPg=0&Increment=50&submit=Search	9JZ	3HL5	42609700	85256447						ZINC39295930	1	HAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFL	7TRL,7TRM	Baculoviral IAP repeat-containing protein 2	BIRC2_HUMAN	Q13490	B4E026 Q16516 Q4TTG0						
