BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
47904	OC(=O)c1cc(Cl)cc(Cl)c1O	InChI=1S/C7H4Cl2O3/c8-3-1-4(7(11)12)6(10)5(9)2-3/h1-2,10H,(H,11,12)	CNJGWCQEGROXEE-UHFFFAOYSA-N	26269	3,5-dichloro-2-hydroxybenzoic acid::3,5-dichlorosalicylic acid::CHEMBL449129	Aldo-keto reductase family 1 member C1 [L306A]	Homo sapiens	 270						7.4	25.00 C	Curated from the literature by BindingDB	10.1021/jm8003575	10.7270/Q2MG7MTW	18620380	aid1798661		Dhagat, U; Endo, S; Sumii, R; Hara, A; El-Kabbani, O	Monash University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=26269	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=3020&target=Aldo-keto+reductase+family+1+member+C1+%5BL306A%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=26269&enzyme=Aldo-keto+reductase+family+1+member+C1+%5BL306A%5D&column=ki&startPg=0&Increment=50&submit=Search	C2U	3CV7,3C3U,3GUG	9445	56464706		CHEMBL449129				ZINC00409156	1	MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYATLDIFAGPPNYPFSDEY	4DZ5,7WQM,7WQR,7WQS,7X3L,7X3M,7X3O	Aldo-keto reductase family 1 member C1	AK1C1_HUMAN	Q04828	P52896 Q5SR15 Q7M4N2 Q9UCX2						
