BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
31351	CC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O	InChI=1S/C24H33N5O5/c1-13(2)20(28-21(30)14(3)25)23(32)29-10-6-9-19(29)22(31)27-18(24(33)34)11-15-12-26-17-8-5-4-7-16(15)17/h4-5,7-8,12-14,18-20,26H,6,9-11,25H2,1-3H3,(H,27,31)(H,28,30)(H,33,34)/t14-,18-,19-,20-/m0/s1	OFKRVBJQENVJEB-DSYPUSFNSA-N	17344	(2S)-2-{[(2S)-1-[(2S)-2-[(2S)-2-aminopropanamido]-3-methylbutanoyl]pyrrolidin-2-yl]formamido}-3-(1H-indol-3-yl)propanoic acid::AVPW::L-alanyl-L-valyl-L-prolyl-L-tryptophan	Baculoviral IAP repeat-containing protein 3 [252-340]	Homo sapiens	 70						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb600276q	10.7270/Q2G15Z34	17168540	aid1797623		Zobel, K; Wang, L; Varfolomeev, E; Franklin, MC; Elliott, LO; Wallweber, HJ; Okawa, DC; Flygare, JA; Vucic, D; Fairbrother, WJ; Deshayes, K	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=17344	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1804&target=Baculoviral+IAP+repeat-containing+protein+3+%5B252-340%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=17344&enzyme=Baculoviral+IAP+repeat-containing+protein+3+%5B252-340%5D&column=ki&startPg=0&Increment=50&submit=Search		2I3H	9549245	46517519					C03803	ZINC14964038	1	MQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPH	2UVL,3UW4,7TRL,7TRM	Baculoviral IAP repeat-containing protein 3	BIRC3_HUMAN	Q13489	Q16628 Q9HC27 Q9UP46						
31352	CN[C@@H](C)C(=O)N[C@H]1CCC[C@H]2SC(C)(C)[C@H](N2C1=O)C(=O)Nc1cc(C)nn1-c1ccccc1	InChI=1S/C25H34N6O3S/c1-15-14-19(31(29-15)17-10-7-6-8-11-17)28-23(33)21-25(3,4)35-20-13-9-12-18(24(34)30(20)21)27-22(32)16(2)26-5/h6-8,10-11,14,16,18,20-21,26H,9,12-13H2,1-5H3,(H,27,32)(H,28,33)/t16-,18-,20+,21+/m0/s1	RBLGKKZTMVKMNE-XIGKFDRGSA-N	17345	(3R,6S,9aR)-2,2-dimethyl-N-(3-methyl-1-phenyl-1H-pyrazol-5-yl)-6-[(2S)-2-(methylamino)propanamido]-5-oxo-octahydroazepino[2,1-b][1,3]thiazole-3-carboxamide::peptide isostere, 8	Baculoviral IAP repeat-containing protein 3 [252-340]	Homo sapiens	 130						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb600276q	10.7270/Q2G15Z34	17168540	aid1797623		Zobel, K; Wang, L; Varfolomeev, E; Franklin, MC; Elliott, LO; Wallweber, HJ; Okawa, DC; Flygare, JA; Vucic, D; Fairbrother, WJ; Deshayes, K	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=17345	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1804&target=Baculoviral+IAP+repeat-containing+protein+3+%5B252-340%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=17345&enzyme=Baculoviral+IAP+repeat-containing+protein+3+%5B252-340%5D&column=ki&startPg=0&Increment=50&submit=Search		2I3I	23647740	46517520						ZINC14964042	1	MQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPH	2UVL,3UW4,7TRL,7TRM	Baculoviral IAP repeat-containing protein 3	BIRC3_HUMAN	Q13489	Q16628 Q9HC27 Q9UP46						
31353	CN[C@@H](C)C(=O)N[C@H]1CCC[C@H]2SC[C@H](N2C1=O)C(=O)Nc1cc(C)nn1-c1ccccc1	InChI=1S/C23H30N6O3S/c1-14-12-19(29(27-14)16-8-5-4-6-9-16)26-22(31)18-13-33-20-11-7-10-17(23(32)28(18)20)25-21(30)15(2)24-3/h4-6,8-9,12,15,17-18,20,24H,7,10-11,13H2,1-3H3,(H,25,30)(H,26,31)/t15-,17-,18-,20+/m0/s1	YYBUDMKKCZIZQP-TXJVSEOTSA-N	17347	(3R,6S,9aR)-N-(3-methyl-1-phenyl-1H-pyrazol-5-yl)-6-[(2S)-2-(methylamino)propanamido]-5-oxo-octahydroazepino[2,1-b][1,3]thiazole-3-carboxamide::peptide isostere, 10	Baculoviral IAP repeat-containing protein 3 [252-340]	Homo sapiens	 490						7.2	22.00 C	Curated from the literature by BindingDB	10.1021/cb600276q	10.7270/Q2G15Z34	17168540	aid1797623		Zobel, K; Wang, L; Varfolomeev, E; Franklin, MC; Elliott, LO; Wallweber, HJ; Okawa, DC; Flygare, JA; Vucic, D; Fairbrother, WJ; Deshayes, K	Genentech	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=17347	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1804&target=Baculoviral+IAP+repeat-containing+protein+3+%5B252-340%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=17347&enzyme=Baculoviral+IAP+repeat-containing+protein+3+%5B252-340%5D&column=ki&startPg=0&Increment=50&submit=Search			23647742	46517522						ZINC14964050	1	MQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPH	2UVL,3UW4,7TRL,7TRM	Baculoviral IAP repeat-containing protein 3	BIRC3_HUMAN	Q13489	Q16628 Q9HC27 Q9UP46