BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51311317	Cc1ccc(cc1S(=O)(=O)NN=C(c1ccccc1)c1ccccc1)[N+]([O-])=O	InChI=1S/C20H17N3O4S/c1-15-12-13-18(23(24)25)14-19(15)28(26,27)22-21-20(16-8-4-2-5-9-16)17-10-6-3-7-11-17/h2-14,22H,1H3	BQPQPVNXMZFXQE-UHFFFAOYSA-N	50532143	CHEMBL4555860	Urease subunit alpha [1-30]/beta/gamma			 68990							ChEMBL	10.1016/j.bmc.2019.01.043	10.7270/Q2FN19P8	30738655			Arshia, na; Begum, F; Almandil, NB; Lodhi, MA; Khan, KM; Hameed, A; Perveen, S	University of Karachi	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50532143	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50005027&target=Urease+subunit+alpha+%5B1-30%5D%2Fbeta%2Fgamma&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50532143&enzyme=Urease+subunit+alpha+%5B1-30%5D%2Fbeta%2Fgamma&column=ki&startPg=0&Increment=50&submit=Search			155556947	440740725							3	MELTPREKDKLLLFTAGLVAERRLARGLKLNYPEAVALISCAIMEGARDGKTVAQLMSEGRTLLTAEQVMEGVPEMIKDIQVECTFPDGTKLVSIHDPIV		Urease subunit gamma	URE3_ECOLX	Q03282								MIPGEIKVNHALGDIELNAGRETQTIQVANHGDRPIQIGSHYHFYEVNDALKFERENTLGFRLNIPAGMAVRFEPGQSRTVELVAFSGKREIYGFHGKVMGKLESEN		Urease subunit beta	URE2_ECOLX	Q03283								MKTISRQAYADMFGPTTGDRLRLADTELFL		Urease subunit alpha	URE1_ECOLX	Q03284