BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
51187125	CCCCCCCCCCCCS(=O)(=O)CC(O)(O)C(F)(F)F	InChI=1S/C15H29F3O4S/c1-2-3-4-5-6-7-8-9-10-11-12-23(21,22)13-14(19,20)15(16,17)18/h19-20H,2-13H2,1H3	PRMXHUVVMHMYJP-UHFFFAOYSA-N	50412686	CHEMBL467450	Juvenile hormone esterase, isoform A/B			 191							ChEMBL	10.1021/tx015508+	10.7270/Q20004ZT	11743738			Wheelock, CE; Severson, TF; Hammock, BD	University of California at Davis	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50412686	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=50001303&target=Juvenile+hormone+esterase%2C+isoform+A%2FB&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50412686&enzyme=Juvenile+hormone+esterase%2C+isoform+A%2FB&column=ki&startPg=0&Increment=50&submit=Search			44569836	163361710		CHEMBL467450				ZINC44406729	2	LPSLSADAEAPSPLSLKADAPLAHIDSGLLGVPYAKQPIGELRVTTLRLIELPPEKLVVGAPVYLYQFSYESPSSAIKQEVVGHIEDLTYVFKGSQYQDIESPTAYQSK		Juvenile hormone esterase, isoform A	JHEA_TRINI	P30809								LPSLSADAEAPSKIDTAYYNGTKTAPVYQYQFGVGIELTYVFKGSQYQDIESPTAYQSK		Juvenile hormone esterase, isoform B	JHEB_TRINI	P30810