BDBM570082 US11427581, Compound 10-10::US11427581, Compound 10-9
SMILES O=C(NC1N=C2C=CC=C(C3CCC(NC(=O)C4CC4(F)F)CC3)C2S1)C1CC1
InChI Key InChIKey=WFTAZYJYEFFSAP-UHFFFAOYSA-N
Data 8 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 8 hits for monomerid = 570082
Affinity DataIC50: 145nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Affinity DataIC50: 245nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
Affinity DataIC50: 259nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
Affinity DataIC50: 835nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and c...More data for this Ligand-Target Pair
Affinity DataIC50: 1.17E+3nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and co...More data for this Ligand-Target Pair
Affinity DataIC50: 2.29E+3nMAssay Description:JAK1 (h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and co...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:JAK2 (h) and 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100M [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (activity and ...More data for this Ligand-Target Pair
