BDBM50602422 CHEMBL5187505

SMILES O=C(Nc1nc2cccc([C@H]3CC[C@@H](NC(=O)[C@H]4CC4(F)F)CC3)n2n1)C1CC1

InChI Key InChIKey=JQKDWSJGLLIFBM-UHFFFAOYSA-N

Data  4 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 4 hits for monomerid = 50602422   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602422BDBM50602422(CHEMBL5187505)
Affinity DataIC50: 48nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602422BDBM50602422(CHEMBL5187505)
Affinity DataIC50: 455nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602422BDBM50602422(CHEMBL5187505)
Affinity DataIC50: 962nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602422BDBM50602422(CHEMBL5187505)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed