BDBM50570299 CHEMBL4879020

SMILES CNc1nc(C)c(s1)-c1nc(Nc2cccc(c2)N2CCNCC2)ncc1C

InChI Key InChIKey=GZDFPDSMIHMTRU-UHFFFAOYSA-N

Data  4 KI

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 4 hits for monomerid = 50570299   

TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
University of Nottingham

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50570299BDBM50570299(CHEMBL4879020)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/20/2022
Entry Details Article
PubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Human)
University of Nottingham

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50570299BDBM50570299(CHEMBL4879020)
Affinity DataKi:  472nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/20/2022
Entry Details Article
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
University of Nottingham

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50570299BDBM50570299(CHEMBL4879020)
Affinity DataKi:  711nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/20/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
University of Nottingham

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50570299BDBM50570299(CHEMBL4879020)
Affinity DataKi:  1.12E+3nMAssay Description:Inhibition of recombinant human full length CDK1/Cyclin B using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/20/2022
Entry Details Article
PubMed