BDBM50564816 CHEMBL4788347

SMILES COc1cc(F)ccc1-c1nc(Nc2ccc3c(N4CCOCC4)c(C(C)=O)c(=O)oc3c2)ncc1F

InChI Key InChIKey=RDOKVGWGKMHBMG-UHFFFAOYSA-N

Data  13 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 13 hits for monomerid = 50564816   

TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 2.60nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/23/2022
Entry Details Article
PubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 320nMAssay Description:Inhibition of CDK2/Cyclin A (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 336nMAssay Description:Inhibition of CDK6/Cyclin D3 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 471nMAssay Description:Inhibition of CDK4/Cyclin D1 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.01E+3nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.26E+3nMAssay Description:Inhibition of CDK5/p25 (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma] ATP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.51E+3nMAssay Description:Inhibition of CDK3/Cyclin E (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.96E+3nMAssay Description:Inhibition of CDK1/Cyclin B (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-C(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 6.50E+3nMAssay Description:Inhibition of CDK8/Cyclin C (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetPotassium voltage-gated channel subfamily H member 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.01E+4nMAssay Description:Inhibition of fluorescently labeled tracer binding to human ERG by competitive binding assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-C/Cyclin-dependent kinase 19(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.55E+4nMAssay Description:Inhibition of CDK19/Cyclin C (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50564816BDBM50564816(CHEMBL4788347)
Affinity DataIC50: 1.66E+4nMAssay Description:Inhibition of CDK7/Cyclin H (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed