BDBM50559279 CHEMBL4754856

SMILES COC(=O)\C=C\CN1CCc2cc(Nc3ncc(C)c(n3)-c3cnn(c3)C(C)C)ccc2C1

InChI Key InChIKey=VBNPFKOUEKQSDK-UHFFFAOYSA-N

Data  8 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 8 hits for monomerid = 50559279   

TargetTyrosine-protein kinase JAK2(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetTyrosine-protein kinase JAK2(Mouse)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 10nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetTyrosine-protein kinase JAK2(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 14nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 23nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetTyrosine-protein kinase JAK1(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 26nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetTyrosine-protein kinase JAK3(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 77nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 88nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
West China Hospital of Sichuan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50559279BDBM50559279(CHEMBL4754856)
Affinity DataIC50: 497nMAssay Description:Inhibition of FLT3 ITD mutant in human MOLM13 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed