BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 1541429 Cc3nn(c2ncc(C(=O)N[C@@H]1CC[C@@H](C(C)(C)O)CC1)cn2)c4cc(F)ccc34 750572 US20250195518, Example 1 Hematopoietic prostaglandin D synthase Homo sapiens 3.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750572 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750572&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 169159876 519649166 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541430 Cc3nn(c2ncc(C(=O)N[C@@H]1CC[C@@H](CC(C)(C)O)CC1)cn2)c4cnccc34 750574 US20250195518, Example 3 Hematopoietic prostaglandin D synthase Homo sapiens 21.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750574 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750574&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 169159884 519649168 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541431 Cc3nn(c2ncc(C(=O)N[C@@H]1CC[C@@H](OCC(C)(C)O)CC1)cn2)c4ccccc34 750576 US20250195518, Example 4 Hematopoietic prostaglandin D synthase Homo sapiens 5.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750576 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750576&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 169159917 519649170 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541432 CS(=O)(=O)CCCO[C@@H]4CC[C@@H](NC(=O)c3cnc(n2nc(C(F)F)c1ccccc12)nc3)CC4 750577 US20250195518, Example 6 Hematopoietic prostaglandin D synthase Homo sapiens 3.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750577 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750577&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 169159896 519649171 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541433 Cc4nn(c3ncc(C(=O)NC12CC(C(C)(C)O)(C1)C2)cn3)c5cc(F)ccc45 750578 US20250195518, Example 7 Hematopoietic prostaglandin D synthase Homo sapiens 11.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750578 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750578&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 169159861 519649172 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541434 CC(C)(O)[C@@H]4CC[C@@H](NC(=O)c3cnc(n2nc(C(F)F)c1ccncc12)nc3)CC4 750579 US20250195518, Example 9 Hematopoietic prostaglandin D synthase Homo sapiens 13.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750579 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750579&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 169159915 519649173 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541435 Cc3nn(c2ccc(C(=O)N[C@H]1CC[C@H](OC(C)(C)CO)CC1)cc2)c4ccccc34 750580 US20250195518, Example 11 Hematopoietic prostaglandin D synthase Homo sapiens 171 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750580 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750580&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 177372994 519649174 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541436 Cc3nn(c2ccc(C(=O)N[C@H]1CC[C@H](C(C)(C)O)CC1)cn2)c4ccccc34 750581 US20250195518, Example 15 Hematopoietic prostaglandin D synthase Homo sapiens 12.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750581 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750581&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 177372995 519649175 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541437 CC(C)(O)[C@H]1CC[C@H](NC(=O)c2ccc(-n3nc(Cl)c4ccccc43)nc2)CC1 750582 US20250195518, Example 17 Hematopoietic prostaglandin D synthase Homo sapiens 27.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750582 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750582&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790927 519649176 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541438 Cc1nn(-c2ncc(C(=O)N[C@H]3CC[C@H](O)CC3)cn2)c2ccccc12 750583 US20250195518, Example 18 Hematopoietic prostaglandin D synthase Homo sapiens 45.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750583 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750583&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790898 519649177 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541439 Cc1nn(-c2ncc(C(=O)N[C@H]3CC[C@H](C)CC3)cn2)c2ccccc12 750584 US20250195518, Example 19 Hematopoietic prostaglandin D synthase Homo sapiens 4.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750584 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750584&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790831 519649178 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541440 CC(C)(O)[C@H]1CC[C@H](NC(=O)c2cnc(-n3nc(Cl)c4ccccc43)nc2)CC1 750585 US20250195518, Example 24 Hematopoietic prostaglandin D synthase Homo sapiens 3.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750585 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750585&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791023 519649179 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541441 COc1nn(-c2ncc(C(=O)N[C@H]3CC[C@H](O)CC3)cn2)c2ccccc12 750586 US20250195518, Example 27 Hematopoietic prostaglandin D synthase Homo sapiens 225 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750586 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750586&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790825 519649180 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541442 Cc1nn(-c2ccc(C(=O)N[C@H]3CC[C@H](O)CC3)cn2)c2cc(F)ccc12 750587 US20250195518, Example 39 Hematopoietic prostaglandin D synthase Homo sapiens 71.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750587 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750587&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790913 519649181 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541443 Cc1nn(-c2ccc(C(=O)N[C@H]3CC[C@H](C(C)(C)O)CC3)cn2)c2cc(F)ccc12 750588 US20250195518, Example 40 Hematopoietic prostaglandin D synthase Homo sapiens 7.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750588 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750588&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791026 519649182 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541444 Cc1nn(-c2ccc(C(=O)N[C@H]3CC[C@H](O)CC3)cn2)c2c(F)cccc12 750589 US20250195518, Example 41 Hematopoietic prostaglandin D synthase Homo sapiens 374 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750589 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750589&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791168 519649183 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541445 Cc1nn(-c2ncc(C(=O)N[C@H]3CC[C@H](O)CC3)cn2)c2cccc(F)c12 750590 US20250195518, Example 42 Hematopoietic prostaglandin D synthase Homo sapiens 200 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750590 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750590&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790873 519649184 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541446 CC(C)(O)[C@H]1CC[C@H](NC(=O)c2cnc(-n3nc(C(F)(F)F)c4ccccc43)nc2)CC1 750591 US20250195518, Example 46 Hematopoietic prostaglandin D synthase Homo sapiens 10.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750591 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750591&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790959 519649185 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541447 Cc1nn(-c2ccc(C(=O)N[C@H]3CC[C@H](C(C)(C)O)CC3)cn2)c2cccc(F)c12 750592 US20250195518, Example 50 Hematopoietic prostaglandin D synthase Homo sapiens 74.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750592 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750592&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791073 519649186 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541448 Cc1nn(-c2ncc(C(=O)N[C@H]3CC[C@H](O)CC3)cc2F)c2ccccc12 750593 US20250195518, Example 54 Hematopoietic prostaglandin D synthase Homo sapiens 41.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750593 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750593&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790973 519649187 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541449 Cc1nn(-c2ncc(C(N)=O)cc2F)c2ccccc12 750594 US20250195518, Example 55 Hematopoietic prostaglandin D synthase Homo sapiens 3.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750594 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750594&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790963 519649188 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541450 Cc1nn(-c2ccc(C(=O)N[C@H]3CC[C@H](OC4CCS(=O)(=O)CC4)CC3)cn2)c2cc(F)ccc12 750595 US20250195518, Example 80 Hematopoietic prostaglandin D synthase Homo sapiens 17.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750595 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750595&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791067 519649189 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541451 Cc1nn(-c2ncc(C(=O)N[C@H]3CC[C@H](C(C)(C)O)CC3)cn2)c2c(C#N)cccc12 750596 US20250195518, Example 95 Hematopoietic prostaglandin D synthase Homo sapiens 144 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750596 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750596&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791091 519649190 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541452 CC[C@H]1CC[C@H](NC(=O)c2cnc(-n3nc(C)c4ccc(F)cc43)nc2)CC1 750597 US20250195518, Example 128 Hematopoietic prostaglandin D synthase Homo sapiens 5.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750597 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750597&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790801 519649191 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541453 Cc1nn(-c2ncc(C(=O)NC3CCCCC3)cn2)c2c(F)c(F)ccc12 750598 US20250195518, Example 143 Hematopoietic prostaglandin D synthase Homo sapiens 24.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750598 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750598&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790933 519649192 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541454 Cc1nn(-c2ncc(C(=O)NC3CCCCC3)cn2)c2c(F)c(F)ccc12 750599 US20250195518, Example 144 Hematopoietic prostaglandin D synthase Homo sapiens 41.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750599 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750599&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790933 519649193 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541455 Cc1nc([C@H]2CC[C@H](NC(=O)c3cnc(-n4nc(C)c5ccc(F)cc54)nc3)CC2)no1 750600 US20250195518, Example 150 Hematopoietic prostaglandin D synthase Homo sapiens 14.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750600 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750600&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790979 519649194 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541456 Cc1nn(-c2ncc(C(=O)NC3CCCCC3)cn2)c2cnccc12 750601 US20250195518, Example 173 Hematopoietic prostaglandin D synthase Homo sapiens 14.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750601 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750601&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791031 519649195 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541457 CC(=O)N1CCC[C@@H](NC(=O)c2cnc(-n3nc(C(F)F)c4ccccc43)nc2)C1 750602 US20250195518, Example 196 Hematopoietic prostaglandin D synthase Homo sapiens 14.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750602 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750602&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790896 519649196 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541458 Cc1nn(-c2ncc(C(=O)N[C@H]3CC[C@@](C)(O)CC3)cn2)c2cc(F)ccc12 750603 US20250195518, Example 204 Hematopoietic prostaglandin D synthase Homo sapiens 14.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750603 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750603&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176790895 519649197 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541459 CC(C)(O)C(=O)N1CCC(NC(=O)c2cnc(-n3nc(C(F)F)c4ccc(F)cc43)nc2)CC1 750604 US20250195518, Example 254 Hematopoietic prostaglandin D synthase Homo sapiens 14.0 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750604 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750604&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791081 519649198 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9 1541460 CC(C)(O)C12CC(NC(=O)c3cnc(-n4nc(C(F)F)c5ccccc54)nc3)(C1)C2 750605 US20250195518, Example 255 Hematopoietic prostaglandin D synthase Homo sapiens 7.00 US Patent 10.7270/Q2R49WBG US20250195518 NAGAMOTO, Y; TAKAGI, M; MATSUMURA, K; ITO, H; ITO, K; OYAMA, Y 6/19/2025 10/14/2025 Japan Tobacco http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=750605 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=2173&target=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=750605&enzyme=Hematopoietic+prostaglandin+D+synthase&column=ki&startPg=0&Increment=50&submit=Search 176791180 519649199 1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL 6W58,2VD1,2VD0,2VCZ,2VCX,2VCW,2VCQ,3KXO,4EC0,7JR8,7JR6,6ZTC,6N4E,6W8H,4EDZ,5AIS,4EE0,4EDY,5YX1,5YWX,5YWE Hematopoietic prostaglandin D synthase HPGDS_HUMAN O60760 Q6FHT9