BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
1481248	N=C1c2sc(cc2C(=O)NC1=O)-c1ccccc1	InChI=1S/C13H8N2O2S/c14-10-11-8(12(16)15-13(10)17)6-9(18-11)7-4-2-1-3-5-7/h1-6,14H,(H,15,16,17)	CQHAROORCYWRRH-UHFFFAOYSA-N	396097	US10308663, JMS-631-053::US12227515, Compound JMS-053	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 34.7							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396097	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396097&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			124141953	405266169							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481249	O=C1NC(=O)C(=O)c2sc(cc12)-c1ccccc1	InChI=1S/C13H7NO3S/c15-10-11-8(12(16)14-13(10)17)6-9(18-11)7-4-2-1-3-5-7/h1-6H,(H,14,16,17)	IMDNSVLQVQIAKK-UHFFFAOYSA-N	50535759	CHEMBL4471843::US12227515, Compound 3	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 49.5							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50535759	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50535759&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			139193964	440744341							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481250	O=C1NC(=O)c2sc(-c3ccccc3)cc2C1=O	InChI=1S/C13H7NO3S/c15-10-8-6-9(7-4-2-1-3-5-7)18-11(8)13(17)14-12(10)16/h1-6H,(H,14,16,17)	DLTOPBASXVLYDF-UHFFFAOYSA-N	713951	US12202839, Compound 15	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 162							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713951	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713951&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146610348	513834003							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481251	Cc1ccc(-c2cc3c(s2)C(=N)C(=O)NC3=O)cc1	InChI=1S/C14H10N2O2S/c1-7-2-4-8(5-3-7)10-6-9-12(19-10)11(15)14(18)16-13(9)17/h2-6,15H,1H3,(H,16,17,18)	ASRIVMACKIQEAX-UHFFFAOYSA-N	713952	US12202839, Compound 9a	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 61.7							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713952	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713952&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146611783	513834004							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481252	N=C1C(=O)NC(=O)c2cc(-c3ccc(Cl)cc3)sc21	InChI=1S/C13H7ClN2O2S/c14-7-3-1-6(2-4-7)9-5-8-11(19-9)10(15)13(18)16-12(8)17/h1-5,15H,(H,16,17,18)	QSICMQHKXUAHCP-UHFFFAOYSA-N	713953	US12202839, Compound 9b	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 41.9							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713953	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713953&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146610878	513834005							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481253	N=c2c(=O)[nH]c(=O)c3cc(c1ccc(C(F)(F)F)cc1)sc23	InChI=1S/C14H7F3N2O2S/c15-14(16,17)7-3-1-6(2-4-7)9-5-8-11(22-9)10(18)13(21)19-12(8)20/h1-5,18H,(H,19,20,21)	KOSNPFKKHBCHTR-UHFFFAOYSA-N	713954	US12227515, Compound 9a	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 62.5							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713954	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713954&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146610879	513834006							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481254	N=C1C(=O)NC(=O)c2cc(-c3ccc(F)cc3)sc21	InChI=1S/C13H7FN2O2S/c14-7-3-1-6(2-4-7)9-5-8-11(19-9)10(15)13(18)16-12(8)17/h1-5,15H,(H,16,17,18)	OIQSPNOVWKVALQ-UHFFFAOYSA-N	713955	US12202839, Compound 9d	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 71.0							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713955	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713955&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146612282	513834007							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481255	CC(C)(C)C(=O)Oc1ccc(-c2cc3c(s2)C(=N)C(=O)NC3=O)cc1	InChI=1S/C18H16N2O4S/c1-18(2,3)17(23)24-10-6-4-9(5-7-10)12-8-11-14(25-12)13(19)16(22)20-15(11)21/h4-8,19H,1-3H3,(H,20,21,22)	NDDLIVYJHIKHHI-UHFFFAOYSA-N	713956	US12202839, Compound 9e	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 256							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713956	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713956&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146571516	513834008							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481256	N=C1C(=O)NC(=O)c2cc(-c3cccc(F)c3)sc21	InChI=1S/C13H7FN2O2S/c14-7-3-1-2-6(4-7)9-5-8-11(19-9)10(15)13(18)16-12(8)17/h1-5,15H,(H,16,17,18)	ULOBPALUSUXPOB-UHFFFAOYSA-N	713957	US12202839, Compound 9f	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 39.1							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713957	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713957&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			162503149	513834009							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481257	N=c2c(=O)[nH]c(=O)c3cc(c1cccc(C(F)(F)F)c1)sc23	InChI=1S/C14H7F3N2O2S/c15-14(16,17)7-3-1-2-6(4-7)9-5-8-11(22-9)10(18)13(21)19-12(8)20/h1-5,18H,(H,19,20,21)	JKHLWVNUTVAQBJ-UHFFFAOYSA-N	713958	US12202839, Compound 9g	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 193							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713958	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713958&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146613241	513834010							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481258	N=C1C(=O)NC(=O)c2cc(-c3cccc(Cl)c3)sc21	InChI=1S/C13H7ClN2O2S/c14-7-3-1-2-6(4-7)9-5-8-11(19-9)10(15)13(18)16-12(8)17/h1-5,15H,(H,16,17,18)	SQOJUYFBJNJDNU-UHFFFAOYSA-N	713959	US12202839, Compound 9h	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 65.7							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713959	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713959&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146611785	513834011							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481259	Cc1cccc(-c2cc3c(s2)C(=N)C(=O)NC3=O)c1	InChI=1S/C14H10N2O2S/c1-7-3-2-4-8(5-7)10-6-9-12(19-10)11(15)14(18)16-13(9)17/h2-6,15H,1H3,(H,16,17,18)	YSNNAMTUJORARK-UHFFFAOYSA-N	713960	US12202839, Compound 9i	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 53.4							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713960	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713960&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146612280	513834012							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481260	COc1cccc(-c2cc3c(s2)C(=N)C(=O)NC3=O)c1	InChI=1S/C14H10N2O3S/c1-19-8-4-2-3-7(5-8)10-6-9-12(20-10)11(15)14(18)16-13(9)17/h2-6,15H,1H3,(H,16,17,18)	SCCLHCBUCGGYDK-UHFFFAOYSA-N	713961	US12202839, Compound 9j	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 47.6							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713961	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713961&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146612581	513834013							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481261	N=C1C(=O)NC(=O)c2cc(-c3ccccc3Cl)sc21	InChI=1S/C13H7ClN2O2S/c14-8-4-2-1-3-6(8)9-5-7-11(19-9)10(15)13(18)16-12(7)17/h1-5,15H,(H,16,17,18)	DXWKXJCHISYLMA-UHFFFAOYSA-N	713962	US12202839, Compound 9k	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 36.1							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713962	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713962&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			153589098	513834014							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481262	N=C1C(=O)NC(=O)c2cc(-c3ccccc3F)sc21	InChI=1S/C13H7FN2O2S/c14-8-4-2-1-3-6(8)9-5-7-11(19-9)10(15)13(18)16-12(7)17/h1-5,15H,(H,16,17,18)	XAJBUCBMAQLFSE-UHFFFAOYSA-N	713963	US12202839, Compound 9l	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 53.4							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713963	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713963&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			153589084	513834015							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481263	N=C1C(=O)NC(=O)c2cc(-c3ccc(Cl)c(F)c3)sc21	InChI=1S/C13H6ClFN2O2S/c14-7-2-1-5(3-8(7)15)9-4-6-11(20-9)10(16)13(19)17-12(6)18/h1-4,16H,(H,17,18,19)	IVMJFKWAGAVMTK-UHFFFAOYSA-N	713964	US12202839, Compound 9m	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 47.4							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713964	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713964&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146610347	513834016							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481264	N=C1C(=O)NC(=O)c2cc(-c3ccc(F)c(Cl)c3)sc21	InChI=1S/C13H6ClFN2O2S/c14-7-3-5(1-2-8(7)15)9-4-6-11(20-9)10(16)13(19)17-12(6)18/h1-4,16H,(H,17,18,19)	YZCAFYIWZKVKTB-UHFFFAOYSA-N	713965	US12202839, Compound 9n	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 67.7							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713965	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713965&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			153589099	513834017							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481265	N=C1C(=O)NC(=O)c2cc(-c3ccc(OCCN4CCOCC4)cc3)sc21	InChI=1S/C19H19N3O4S/c20-16-17-14(18(23)21-19(16)24)11-15(27-17)12-1-3-13(4-2-12)26-10-7-22-5-8-25-9-6-22/h1-4,11,20H,5-10H2,(H,21,23,24)	LHBMAGYLRQENLH-UHFFFAOYSA-N	713966	US12202839, Compound 9o	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 98.2							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713966	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713966&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			162503164	513834018							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481266	N=C1C(=O)N(CC2CC2)C(=O)c2cc(-c3ccccc3)sc21	InChI=1S/C17H14N2O2S/c18-14-15-12(8-13(22-15)11-4-2-1-3-5-11)16(20)19(17(14)21)9-10-6-7-10/h1-5,8,10,18H,6-7,9H2	GXKHZCSDVVDREL-UHFFFAOYSA-N	713967	US12202839, Compound 9q	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 85.7							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713967	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713967&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146571521	513834019							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481267	CN1C(=O)C(=O)c2sc(-c3ccccc3)cc2C1=O	InChI=1S/C14H9NO3S/c1-15-13(17)9-7-10(8-5-3-2-4-6-8)19-12(9)11(16)14(15)18/h2-7H,1H3	RYVXTBKDGMWCHF-UHFFFAOYSA-N	713968	US12202839, Compound NRT-892-04	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 32.2							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713968	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713968&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146612276	513834020							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481268	CN1C(=O)C(=N)c2sc(-c3ccccc3)cc2C1=O	InChI=1S/C14H10N2O2S/c1-16-13(17)9-7-10(8-5-3-2-4-6-8)19-12(9)11(15)14(16)18/h2-7,15H,1H3	IGPZTAJCUQIMOK-UHFFFAOYSA-N	713969	US12202839, Compound 9p	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 48.9							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713969	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713969&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146611071	513834021							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481269	N=C1c2sc(cc2C(=O)NC1=O)-c1ccc(OCCCCOC(=O)CC23CC4CC(CC(C4)C2)C3)cc1 |TLB:24:25:28.27.32:30,THB:26:27:30:34.25.33,26:25:28.27.32:30,33:25:28:32.31.30,33:31:28:34.26.25,24:25:28:32.31.30|			50571227	CHEMBL4854258::US12227515, Compound EJR-876-34	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 4976							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50571227	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50571227&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			162503168	471061372							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481270	N=C1c2sc(cc2C(=O)NC1=O)-c1ccc(OCCCCNC(=O)CC23CC4CC(CC(C4)C2)C3)cc1 |TLB:24:25:28.27.32:30,THB:26:27:30:34.25.33,26:25:28.27.32:30,33:25:28:32.31.30,33:31:28:34.26.25,24:25:28:32.31.30|			50571229	CHEMBL4852178::US12227515, Compound EJR-876-35	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 643							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50571229	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50571229&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			162503145	471061374							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481271	N=C1c2sc(cc2C(=O)NC1=O)-c1ccc(OCC(=O)NCCCNC(=O)CC23CC4CC(CC(C4)C2)C3)cc1 |TLB:27:28:31.30.35:33,THB:29:30:33:37.28.36,29:28:31.30.35:33,36:28:31:35.34.33,36:34:31:37.29.28,27:28:31:35.34.33|			50571225	CHEMBL4862502::US12227515, Compound EJR-887-24	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 206							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50571225	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50571225&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			162503147	471061370							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481272	N=C1c2sc(cc2C(=O)NC1=O)-c1ccc(OCC(=O)NCCOCCOCCNC(=O)CC23CC4CC(CC(C4)C2)C3)cc1 |TLB:32:33:36.35.40:38,THB:34:35:38:42.33.41,34:33:36.35.40:38,41:33:36:40.39.38,41:39:36:42.34.33,32:33:36:40.39.38|			50571230	CHEMBL4862721::US12227515, Compound EJR-887-35	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 107							US Patent		10.7270/Q2X06CKF		aid2060930	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50571230	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50571230&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			164625444	471061375							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481273	N=C1c2sc(cc2C(=O)NC1=O)-c1ccccc1	InChI=1S/C13H8N2O2S/c14-10-11-8(12(16)15-13(10)17)6-9(18-11)7-4-2-1-3-5-7/h1-6,14H,(H,15,16,17)	CQHAROORCYWRRH-UHFFFAOYSA-N	396097	US10308663, JMS-631-053::US12227515, Compound JMS-053	Protein tyrosine phosphatase type IVA 1 (PTP4A1)	Homo sapiens		 29.1							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396097	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004458&target=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396097&enzyme=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search			124141953	405266169							1	MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ	5LXQ,5MMZ,3RZ2,1X24,1RXD,5BX1,1ZCK,6WUR	Protein tyrosine phosphatase type IVA 1	TP4A1_HUMAN	Q93096	B2R6C8 O00648 Q49A54																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481274	N=C1c2sc(cc2C(=O)NC1=O)-c1ccccc1	InChI=1S/C13H8N2O2S/c14-10-11-8(12(16)15-13(10)17)6-9(18-11)7-4-2-1-3-5-7/h1-6,14H,(H,15,16,17)	CQHAROORCYWRRH-UHFFFAOYSA-N	396097	US10308663, JMS-631-053::US12227515, Compound JMS-053	Protein tyrosine phosphatase type IVA 2 (PTP4A2)	Homo sapiens		 48.0							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396097	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004459&target=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396097&enzyme=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search			124141953	405266169							1	MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ	5K25,5K23,5K24,1XM2,1ZCL	Protein tyrosine phosphatase type IVA 2	TP4A2_HUMAN	Q12974	A8K9I8 B4DM39 D3DPP0 E9PGJ6 O00649 Q15197 Q15259 Q15260 Q15261 R4GN50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481275	N=C1c2sc(cc2C(=O)NC1=O)-c1ccccc1	InChI=1S/C13H8N2O2S/c14-10-11-8(12(16)15-13(10)17)6-9(18-11)7-4-2-1-3-5-7/h1-6,14H,(H,15,16,17)	CQHAROORCYWRRH-UHFFFAOYSA-N	396097	US10308663, JMS-631-053::US12227515, Compound JMS-053	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 34.7							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396097	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396097&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			124141953	405266169							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481276	N=C1C(=O)NC(=O)c2cc(-c3ccccc3Cl)sc21	InChI=1S/C13H7ClN2O2S/c14-8-4-2-1-3-6(8)9-5-7-11(19-9)10(15)13(18)16-12(7)17/h1-5,15H,(H,16,17,18)	DXWKXJCHISYLMA-UHFFFAOYSA-N	713962	US12202839, Compound 9k	Protein tyrosine phosphatase type IVA 1 (PTP4A1)	Homo sapiens		 49.0							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713962	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004458&target=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713962&enzyme=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search			153589098	513834014							1	MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ	5LXQ,5MMZ,3RZ2,1X24,1RXD,5BX1,1ZCK,6WUR	Protein tyrosine phosphatase type IVA 1	TP4A1_HUMAN	Q93096	B2R6C8 O00648 Q49A54																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481277	N=C1C(=O)NC(=O)c2cc(-c3ccccc3Cl)sc21	InChI=1S/C13H7ClN2O2S/c14-8-4-2-1-3-6(8)9-5-7-11(19-9)10(15)13(18)16-12(7)17/h1-5,15H,(H,16,17,18)	DXWKXJCHISYLMA-UHFFFAOYSA-N	713962	US12202839, Compound 9k	Protein tyrosine phosphatase type IVA 2 (PTP4A2)	Homo sapiens		 113							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713962	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004459&target=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713962&enzyme=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search			153589098	513834014							1	MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ	5K25,5K23,5K24,1XM2,1ZCL	Protein tyrosine phosphatase type IVA 2	TP4A2_HUMAN	Q12974	A8K9I8 B4DM39 D3DPP0 E9PGJ6 O00649 Q15197 Q15259 Q15260 Q15261 R4GN50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481278	N=C1C(=O)NC(=O)c2cc(-c3ccccc3Cl)sc21	InChI=1S/C13H7ClN2O2S/c14-8-4-2-1-3-6(8)9-5-7-11(19-9)10(15)13(18)16-12(7)17/h1-5,15H,(H,16,17,18)	DXWKXJCHISYLMA-UHFFFAOYSA-N	713962	US12202839, Compound 9k	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 36.1							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713962	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713962&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			153589098	513834014							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481279	N=C1C(=O)NC(=O)c2cc(-c3ccc(OCCN4CCOCC4)cc3)sc21	InChI=1S/C19H19N3O4S/c20-16-17-14(18(23)21-19(16)24)11-15(27-17)12-1-3-13(4-2-12)26-10-7-22-5-8-25-9-6-22/h1-4,11,20H,5-10H2,(H,21,23,24)	LHBMAGYLRQENLH-UHFFFAOYSA-N	713966	US12202839, Compound 9o	Protein tyrosine phosphatase type IVA 1 (PTP4A1)	Homo sapiens		 43.2							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713966	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004458&target=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713966&enzyme=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search			162503164	513834018							1	MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ	5LXQ,5MMZ,3RZ2,1X24,1RXD,5BX1,1ZCK,6WUR	Protein tyrosine phosphatase type IVA 1	TP4A1_HUMAN	Q93096	B2R6C8 O00648 Q49A54																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481280	N=C1C(=O)NC(=O)c2cc(-c3ccc(OCCN4CCOCC4)cc3)sc21	InChI=1S/C19H19N3O4S/c20-16-17-14(18(23)21-19(16)24)11-15(27-17)12-1-3-13(4-2-12)26-10-7-22-5-8-25-9-6-22/h1-4,11,20H,5-10H2,(H,21,23,24)	LHBMAGYLRQENLH-UHFFFAOYSA-N	713966	US12202839, Compound 9o	Protein tyrosine phosphatase type IVA 2 (PTP4A2)	Homo sapiens		 73.9							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713966	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004459&target=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713966&enzyme=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search			162503164	513834018							1	MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ	5K25,5K23,5K24,1XM2,1ZCL	Protein tyrosine phosphatase type IVA 2	TP4A2_HUMAN	Q12974	A8K9I8 B4DM39 D3DPP0 E9PGJ6 O00649 Q15197 Q15259 Q15260 Q15261 R4GN50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481281	N=C1C(=O)NC(=O)c2cc(-c3ccc(OCCN4CCOCC4)cc3)sc21	InChI=1S/C19H19N3O4S/c20-16-17-14(18(23)21-19(16)24)11-15(27-17)12-1-3-13(4-2-12)26-10-7-22-5-8-25-9-6-22/h1-4,11,20H,5-10H2,(H,21,23,24)	LHBMAGYLRQENLH-UHFFFAOYSA-N	713966	US12202839, Compound 9o	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 98.2							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713966	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713966&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			162503164	513834018							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481282	CN1C(=O)C(=N)c2sc(-c3ccccc3)cc2C1=O	InChI=1S/C14H10N2O2S/c1-16-13(17)9-7-10(8-5-3-2-4-6-8)19-12(9)11(15)14(16)18/h2-7,15H,1H3	IGPZTAJCUQIMOK-UHFFFAOYSA-N	713969	US12202839, Compound 9p	Protein tyrosine phosphatase type IVA 1 (PTP4A1)	Homo sapiens		 133							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713969	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004458&target=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713969&enzyme=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search			146611071	513834021							1	MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ	5LXQ,5MMZ,3RZ2,1X24,1RXD,5BX1,1ZCK,6WUR	Protein tyrosine phosphatase type IVA 1	TP4A1_HUMAN	Q93096	B2R6C8 O00648 Q49A54																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481283	CN1C(=O)C(=N)c2sc(-c3ccccc3)cc2C1=O	InChI=1S/C14H10N2O2S/c1-16-13(17)9-7-10(8-5-3-2-4-6-8)19-12(9)11(15)14(16)18/h2-7,15H,1H3	IGPZTAJCUQIMOK-UHFFFAOYSA-N	713969	US12202839, Compound 9p	Protein tyrosine phosphatase type IVA 2 (PTP4A2)	Homo sapiens		 264							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713969	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004459&target=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713969&enzyme=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search			146611071	513834021							1	MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ	5K25,5K23,5K24,1XM2,1ZCL	Protein tyrosine phosphatase type IVA 2	TP4A2_HUMAN	Q12974	A8K9I8 B4DM39 D3DPP0 E9PGJ6 O00649 Q15197 Q15259 Q15260 Q15261 R4GN50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481284	CN1C(=O)C(=N)c2sc(-c3ccccc3)cc2C1=O	InChI=1S/C14H10N2O2S/c1-16-13(17)9-7-10(8-5-3-2-4-6-8)19-12(9)11(15)14(16)18/h2-7,15H,1H3	IGPZTAJCUQIMOK-UHFFFAOYSA-N	713969	US12202839, Compound 9p	Protein tyrosine phosphatase type IVA 3	Homo sapiens		 86.0							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=713969	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=713969&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			146611071	513834021							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481285	O=c1[nH]c2sc(cc2c(=O)[nH]1)-c1ccccc1	InChI=1S/C12H8N2O2S/c15-10-8-6-9(7-4-2-1-3-5-7)17-11(8)14-12(16)13-10/h1-6H,(H2,13,14,15,16)	SBSYHISFNMCGGV-UHFFFAOYSA-N	396098	US10308663, JMS-557-038::US12227515, Compound JMS-038	Protein tyrosine phosphatase type IVA 1 (PTP4A1)	Homo sapiens		>1000							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396098	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004458&target=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396098&enzyme=Protein+tyrosine+phosphatase+type+IVA+1+%28PTP4A1%29&column=ki&startPg=0&Increment=50&submit=Search			85138935	405266170							1	MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ	5LXQ,5MMZ,3RZ2,1X24,1RXD,5BX1,1ZCK,6WUR	Protein tyrosine phosphatase type IVA 1	TP4A1_HUMAN	Q93096	B2R6C8 O00648 Q49A54																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481286	O=c1[nH]c2sc(cc2c(=O)[nH]1)-c1ccccc1	InChI=1S/C12H8N2O2S/c15-10-8-6-9(7-4-2-1-3-5-7)17-11(8)14-12(16)13-10/h1-6H,(H2,13,14,15,16)	SBSYHISFNMCGGV-UHFFFAOYSA-N	396098	US10308663, JMS-557-038::US12227515, Compound JMS-038	Protein tyrosine phosphatase type IVA 2 (PTP4A2)	Homo sapiens		>1000							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396098	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004459&target=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396098&enzyme=Protein+tyrosine+phosphatase+type+IVA+2+%28PTP4A2%29&column=ki&startPg=0&Increment=50&submit=Search			85138935	405266170							1	MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ	5K25,5K23,5K24,1XM2,1ZCL	Protein tyrosine phosphatase type IVA 2	TP4A2_HUMAN	Q12974	A8K9I8 B4DM39 D3DPP0 E9PGJ6 O00649 Q15197 Q15259 Q15260 Q15261 R4GN50																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1481287	O=c1[nH]c2sc(cc2c(=O)[nH]1)-c1ccccc1	InChI=1S/C12H8N2O2S/c15-10-8-6-9(7-4-2-1-3-5-7)17-11(8)14-12(16)13-10/h1-6H,(H2,13,14,15,16)	SBSYHISFNMCGGV-UHFFFAOYSA-N	396098	US10308663, JMS-557-038::US12227515, Compound JMS-038	Protein tyrosine phosphatase type IVA 3	Homo sapiens		>1000							US Patent		10.7270/Q2X06CKF		aid2060931	US12202839	Lazo, JS; Sharlow, E; Wipf, P; Tasker, N; Rastelli, E	1/21/2025	5/29/2025	University of Virginia Patent Foundation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=396098	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50003411&target=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=396098&enzyme=Protein+tyrosine+phosphatase+type+IVA+3&column=ki&startPg=0&Increment=50&submit=Search			85138935	405266170							1	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM	1V3A,1R6H,2MBC	Protein tyrosine phosphatase type IVA 3	TP4A3_HUMAN	O75365	Q8IVN5 Q99849 Q9BTW5																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
