BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
1424383	CN(C)CC1(COc2nc3N4CCNC[C@H]4COc4c(Cl)c(cc(n2)c34)-c2cc(O)cc3ccccc23)CC1 |r|	InChI=1S/C30H32ClN5O3/c1-35(2)16-30(7-8-30)17-39-29-33-24-13-23(22-12-20(37)11-18-5-3-4-6-21(18)22)26(31)27-25(24)28(34-29)36-10-9-32-14-19(36)15-38-27/h3-6,11-13,19,32,37H,7-10,14-17H2,1-2H3	SMSKVLGTUYVUIX-UHFFFAOYSA-N	681804	US20240199644, Compound 1	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 3859							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681804	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681804&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171727784	500591640							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424384	CN(C)CC1(COc2nc3N4CCNC[C@@H]4COc4c(Cl)c(cc(n2)c34)-c2cc(O)cc3ccccc23)CC1 |r|	InChI=1S/C30H32ClN5O3/c1-35(2)16-30(7-8-30)17-39-29-33-24-13-23(22-12-20(37)11-18-5-3-4-6-21(18)22)26(31)27-25(24)28(34-29)36-10-9-32-14-19(36)15-38-27/h3-6,11-13,19,32,37H,7-10,14-17H2,1-2H3	SMSKVLGTUYVUIX-UHFFFAOYSA-N	681805	US20240199644, Compound 2	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 880							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681805	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681805&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171727718	500591641							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424385	Oc1cc(-c2cc3nc(OC[C@@]45CCCN4C[C@H](F)C5)nc4N5CCNC[C@@H]5COc(c2Cl)c34)c2ccccc2c1 |r|	InChI=1S/C31H31ClFN5O3/c32-27-24(23-11-21(39)10-18-4-1-2-5-22(18)23)12-25-26-28(27)40-16-20-14-34-7-9-38(20)29(26)36-30(35-25)41-17-31-6-3-8-37(31)15-19(33)13-31/h1-2,4-5,10-12,19-20,34,39H,3,6-9,13-17H2	TXXVTOIGGLYKGW-UHFFFAOYSA-N	681806	US20240199644, Compound 3	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 294							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681806	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681806&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171990595	500591642							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424386	Oc1cc(-c2cc3OC[C@H]4[C@@H]5CC[C@H](CN4c4nc(OCC6(CN7CCOCC7)CC6)nc(c2F)c34)N5)c2c(cccc2c1)C#C |r|	InChI=1S/C36H36FN5O4/c1-2-21-4-3-5-22-14-24(43)15-25(30(21)22)26-16-29-31-33(32(26)37)39-35(46-20-36(8-9-36)19-41-10-12-44-13-11-41)40-34(31)42-17-23-6-7-27(38-23)28(42)18-45-29/h1,3-5,14-16,23,27-28,38,43H,6-13,17-20H2	CCEZKZBORPCURK-UHFFFAOYSA-N	681807	US20240199644, Compound 4	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 2.50							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681807	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681807&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171727759	500591643							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424387	Oc1cc(-c2cc3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OCC6(CN7CCOCC7)CC6)nc(c2F)c34)N5)c2c(cccc2c1)C#C |r|	InChI=1S/C36H36FN5O4/c1-2-21-4-3-5-22-14-24(43)15-25(30(21)22)26-16-29-31-33(32(26)37)39-35(46-20-36(8-9-36)19-41-10-12-44-13-11-41)40-34(31)42-17-23-6-7-27(38-23)28(42)18-45-29/h1,3-5,14-16,23,27-28,38,43H,6-13,17-20H2	CCEZKZBORPCURK-UHFFFAOYSA-N	681808	US20240199644, Compound 5	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 1.16							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681808	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681808&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171727701	500591644							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424388	Oc1cc(-c2nc3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OC[C@@]67CCCN6C[C@H](F)C7)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r|	InChI=1S/C34H31F3N6O3/c1-2-21-23(36)6-4-17-10-20(44)11-22(26(17)21)29-28(37)30-27-31(43-14-19-5-7-24(38-19)25(43)15-45-32(27)39-29)41-33(40-30)46-16-34-8-3-9-42(34)13-18(35)12-34/h1,4,6,10-11,18-19,24-25,38,44H,3,5,7-9,12-16H2	MPCCWLKZACKKGV-UHFFFAOYSA-N	629322	US20240025919, Compound 81::US20230339981, Example 2::US20240199644, Compound 6	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 0.230							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=629322	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=629322&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			167187440	485656998							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424389	Oc1cc(-c2nc3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OCC6(CN7CCOCC7)CC6)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r|	InChI=1S/C35H34F2N6O4/c1-2-22-24(36)5-3-19-13-21(44)14-23(27(19)22)30-29(37)31-28-32(43-15-20-4-6-25(38-20)26(43)16-46-33(28)39-30)41-34(40-31)47-18-35(7-8-35)17-42-9-11-45-12-10-42/h1,3,5,13-14,20,25-26,38,44H,4,6-12,15-18H2	JQADGZCFGZVFDH-UHFFFAOYSA-N	629344	US20230339981, Example 28::US20240199644, Compound 7	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 0.659							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=629344	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=629344&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			169315215	485657020							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424390	Oc1cc(-c2nc3OC[C@H]4[C@H]5CC[C@@H](CN4c4nc(OC[C@@]67CCCN6C[C@H](F)C7)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r|	InChI=1S/C34H31F3N6O3/c1-2-21-23(36)6-4-17-10-20(44)11-22(26(17)21)29-28(37)30-27-31(43-14-19-5-7-24(38-19)25(43)15-45-32(27)39-29)41-33(40-30)46-16-34-8-3-9-42(34)13-18(35)12-34/h1,4,6,10-11,18-19,24-25,38,44H,3,5,7-9,12-16H2	MPCCWLKZACKKGV-UHFFFAOYSA-N	681811	US20240199644, Compound 8	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 32.6							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681811	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681811&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			167275356	500591647							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424391	Oc1cc(-c2nc3OC[C@@H]4[C@H]5CC[C@@H](CN4c4nc(OC[C@@]67CCCN6C[C@H](F)C7)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r|	InChI=1S/C34H31F3N6O3/c1-2-21-23(36)6-4-17-10-20(44)11-22(26(17)21)29-28(37)30-27-31(43-14-19-5-7-24(38-19)25(43)15-45-32(27)39-29)41-33(40-30)46-16-34-8-3-9-42(34)13-18(35)12-34/h1,4,6,10-11,18-19,24-25,38,44H,3,5,7-9,12-16H2	MPCCWLKZACKKGV-UHFFFAOYSA-N	681812	US20240199644, Compound 9	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 81.0							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681812	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681812&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			167187436	500591648							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424392	Oc1cc(-c2cc3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OC[C@@]67CCCN6C[C@H](F)C7)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r|	InChI=1S/C35H32F3N5O3/c1-2-22-25(37)6-4-18-10-21(44)11-23(29(18)22)24-12-28-30-32(31(24)38)40-34(46-17-35-8-3-9-42(35)14-19(36)13-35)41-33(30)43-15-20-5-7-26(39-20)27(43)16-45-28/h1,4,6,10-12,19-20,26-27,39,44H,3,5,7-9,13-17H2	WQIJXHGCGUZFIC-UHFFFAOYSA-N	629373	US20230339981, Example 57::US20240199644, Compound 10	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 0.452							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=629373	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=629373&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			169315391	485657049							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424393	Oc1cc(-c2cc3nc(OC[C@@]45CCCN4C[C@H](F)C5)nc4N5C[C@H]6CC[C@H](N6)[C@H]5COc(c2Cl)c34)c2c(cccc2c1)C#C |r|	InChI=1S/C35H33ClFN5O3/c1-2-19-5-3-6-20-11-23(43)12-24(29(19)20)25-13-27-30-32(31(25)36)44-17-28-26-8-7-22(38-26)16-42(28)33(30)40-34(39-27)45-18-35-9-4-10-41(35)15-21(37)14-35/h1,3,5-6,11-13,21-22,26,28,38,43H,4,7-10,14-18H2	SQYXAJPGHXBYDI-UHFFFAOYSA-N	681814	US20240199644, Compound 11	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 7.24							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681814	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681814&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171727789	500591650							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424394	Oc1cc(-c2c(Cl)c3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OC[C@@]67CCCN6C[C@H](F)C7)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r,wU:11.42,14.41,22.22,wD:10.16,28.30,(-8.79,1.5,;-7.88,.26,;-6.35,.43,;-5.44,-.82,;-4.1,-.05,;-4.1,1.49,;-5.44,2.26,;-2.77,2.26,;-3.17,3.66,;-2.21,4.87,;-.67,4.87,;-.32,6.37,;1.06,7.04,;2.45,6.37,;2.79,4.87,;1.83,3.66,;.29,3.66,;-.1,2.26,;1.23,1.49,;1.23,-.05,;2.56,-.82,;3.9,-.05,;5.23,-.82,;5.71,.65,;7.25,.65,;7.72,-.82,;6.48,-1.72,;6,-3.19,;4.46,-3.19,;3.64,-4.41,;3.99,-1.72,;-.1,-.82,;-1.44,-.05,;-2.77,-.82,;-2.77,-2.36,;-1.44,1.49,;.99,5.05,;-6.06,-2.23,;-5.15,-3.47,;-3.62,-3.3,;-2.09,-3.13,;-5.77,-4.88,;-4.86,-6.12,;-7.3,-5.04,;-8.21,-3.8,;-7.59,-2.39,;-8.5,-1.15,)|	InChI=1S/C35H31ClF3N5O3/c1-2-21-23(38)6-4-17-10-20(45)11-22(26(17)21)27-29(36)32-28-31(30(27)39)41-34(47-16-35-8-3-9-43(35)13-18(37)12-35)42-33(28)44-14-19-5-7-24(40-19)25(44)15-46-32/h1,4,6,10-11,18-19,24-25,40,45H,3,5,7-9,12-16H2	WDAKIDPTOGWLRE-UHFFFAOYSA-N	681815	US20240199644, Compound 12	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 35.8							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681815	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681815&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			167294289	500591651							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424395	Oc1cc(-c2c(Cl)c3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OC[C@@]67CCCN6C[C@H](F)C7)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r,wU:11.42,14.41,22.22,wD:10.16,28.30,(-6.37,-15.61,;-5.46,-16.85,;-3.93,-16.68,;-3.02,-17.92,;-1.69,-17.15,;-1.69,-15.61,;-3.02,-14.84,;-.35,-14.84,;-.75,-13.45,;.21,-12.24,;1.75,-12.24,;2.09,-10.74,;3.48,-10.07,;4.87,-10.74,;5.21,-12.24,;4.25,-13.45,;2.71,-13.45,;2.31,-14.84,;3.65,-15.61,;3.65,-17.15,;4.98,-17.92,;6.31,-17.15,;7.65,-17.92,;8.12,-16.46,;9.66,-16.46,;10.14,-17.92,;8.89,-18.83,;8.42,-20.29,;6.88,-20.29,;6.06,-21.52,;6.4,-18.83,;2.31,-17.92,;.98,-17.15,;-.35,-17.92,;-.35,-19.46,;.98,-15.61,;3.41,-12.06,;-3.64,-19.33,;-2.73,-20.58,;-1.2,-20.41,;.33,-20.24,;-3.35,-21.99,;-2.44,-23.23,;-4.88,-22.15,;-5.79,-20.91,;-5.17,-19.5,;-6.08,-18.26,)|	InChI=1S/C35H31ClF3N5O3/c1-2-21-23(38)6-4-17-10-20(45)11-22(26(17)21)27-29(36)32-28-31(30(27)39)41-34(47-16-35-8-3-9-43(35)13-18(37)12-35)42-33(28)44-14-19-5-7-24(40-19)25(44)15-46-32/h1,4,6,10-11,18-19,24-25,40,45H,3,5,7-9,12-16H2	WDAKIDPTOGWLRE-UHFFFAOYSA-N	681816	US20240199644, Compound 13	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 0.691							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681816	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681816&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			167294289	500591652							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424396	Oc1cc(-c2cc3OC[C@@H]4[C@@H]5CC[C@H](CN4c4nc(OCC6(CN7CCOCC7)CC6)nc(c2F)c34)N5)c2c(C#C)c(F)ccc2c1 |r|	InChI=1S/C36H35F2N5O4/c1-2-23-26(37)5-3-20-13-22(44)14-24(30(20)23)25-15-29-31-33(32(25)38)40-35(47-19-36(7-8-36)18-42-9-11-45-12-10-42)41-34(31)43-16-21-4-6-27(39-21)28(43)17-46-29/h1,3,5,13-15,21,27-28,39,44H,4,6-12,16-19H2	SGZXZFYWIAUQIW-UHFFFAOYSA-N	681817	US20240199644, Compound 14	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 1.15							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681817	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681817&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171727824	500591653							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424397	Oc1cc(-c2cc3OC[C@H]4[C@@H]5C[C@@H](CN5)N4c4nc(OCC5(CN6CCOCC6)CC5)nc(c2F)c34)c2c(cccc2c1)C#C |r|	InChI=1S/C35H34FN5O4/c1-2-20-4-3-5-21-12-23(42)14-24(29(20)21)25-15-28-30-32(31(25)36)38-34(45-19-35(6-7-35)18-40-8-10-43-11-9-40)39-33(30)41-22-13-26(37-16-22)27(41)17-44-28/h1,3-5,12,14-15,22,26-27,37,42H,6-11,13,16-19H2	CRMIZBNBHMVHJV-UHFFFAOYSA-N	681818	US20240199644, Compound 15	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 11.0							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681818	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681818&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			171990596	500591654							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
1424398	Oc1cc(-c2cc3OC[C@H]4[C@H]5C[C@H](CN5)N4c4nc(OCC5(CN6CCOCC6)CC5)nc(c2F)c34)c2c(cccc2c1)C#C |r|	InChI=1S/C35H34FN5O4/c1-2-20-4-3-5-21-12-23(42)14-24(29(20)21)25-15-28-30-32(31(25)36)38-34(45-19-35(6-7-35)18-40-8-10-43-11-9-40)39-33(30)41-22-13-26(37-16-22)27(41)17-44-28/h1,3-5,12,14-15,22,26-27,37,42H,6-11,13,16-19H2	CRMIZBNBHMVHJV-UHFFFAOYSA-N	681819	US20240199644, Compound 16	RAF proto-oncogene serine/threonine-protein kinase [50-132]/GTPase KRas [1-169,G12D]	Homo sapiens		 86.1							US Patent		10.7270/Q2VH5T5M		aid1963818	US20240199644	HAN, H; GAO, P; MA, C; WANG, P; LONG, W; ZHANG, H; ZHANG, L; LIU, D	6/20/2024	9/24/2024	Jacobio Pharmaceuticals	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=681819	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=com&complexid=410&target=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=681819&enzyme=RAF+proto-oncogene+serine%2Fthreonine-protein+kinase+%5B50-132%5D%2FGTPase+KRas+%5B1-169%2CG12D%5D&column=ki&startPg=0&Increment=50&submit=Search			167196366	500591655							2	VKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGM	9O0V,9O0U,9AYA,9AY7,8GFT,3OMV,8CPD,8CHF,8U1L,9AXC,9AXA,9MMS,9MMR,9MMQ,9MMP,8GAE	RAF proto-oncogene serine/threonine-protein kinase	RAF1_HUMAN	P04049	B0LPH8 B2R5N3 Q15278 Q9UC20							MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLK	8JHL,6MQN,7NY8,6YXW,7W5R,7C41,7C40,9I5E,6YR8,9KFL,4TQ9,6GOD,5TB5,5TAR,5UK9,5UFE,5V9O,5V9L,5V71,5KYK,8G4F,6H47,6H46,5O2T,5O2S,5MLB,5MLA,6P0Z,6M9W,5WPM,5WLB,6GOE,5WHB,5WHA,5VQ0,5VPZ,5VPY,5VPI,5VP7,7RP3,9BG5,8EPW,8EBZ,7KFZ,6XGV,6OB3,8AFC,8X6R,8V3A,8V39,8QUG,8AZX,8AFB,7YCE,7YCC,9E9I	GTPase KRas	RASK_HUMAN	P01116	A8K8Z5 B0LPF9 P01118 Q96D10																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																						
