BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 1299273 Fc1ccc(cc1)-n1cnc(n1)N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1 InChI=1S/C23H22ClF2N5O/c24-19-8-7-18(14-20(19)26)31-21(32)2-1-9-23(31)10-12-29(13-11-23)22-27-15-30(28-22)17-5-3-16(25)4-6-17/h3-8,14-15H,1-2,9-13H2 UYATZDSNDGMCMM-UHFFFAOYSA-N 609075 US11708366, Example 1 Leukotriene C4 synthase Homo sapiens 6000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609075 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609075&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778400 483619869 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299274 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nc2ccc(cc2o1)C(F)(F)F InChI=1S/C23H20ClF4N3O2/c24-16-5-4-15(13-17(16)25)31-20(32)2-1-7-22(31)8-10-30(11-9-22)21-29-18-6-3-14(23(26,27)28)12-19(18)33-21/h3-6,12-13H,1-2,7-11H2 HDAVOLMRBZVFHK-UHFFFAOYSA-N 609798 US11708366, Example 2 Leukotriene C4 synthase Homo sapiens 36000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609798 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609798&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778535 483619967 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299275 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nccc(n1)C(F)(F)F InChI=1S/C20H19ClF4N4O/c21-14-4-3-13(12-15(14)22)29-17(30)2-1-6-19(29)7-10-28(11-8-19)18-26-9-5-16(27-18)20(23,24)25/h3-5,9,12H,1-2,6-8,10-11H2 DMHWQRFTLWASAA-UHFFFAOYSA-N 609811 US11708366, Example 3 Leukotriene C4 synthase Homo sapiens 8000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609811 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609811&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778410 483619980 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299276 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ncc2ccc(cc2n1)C(F)(F)F InChI=1S/C24H21ClF4N4O/c25-18-6-5-17(13-19(18)26)33-21(34)2-1-7-23(33)8-10-32(11-9-23)22-30-14-15-3-4-16(24(27,28)29)12-20(15)31-22/h3-6,12-14H,1-2,7-11H2 SXLODLYXCNMAGZ-UHFFFAOYSA-N 609830 US11708366, Example 4 Leukotriene C4 synthase Homo sapiens 7000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609830 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609830&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778571 483619999 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299277 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ccn2nc(cc2n1)C(F)(F)F InChI=1S/C22H20ClF4N5O/c23-15-4-3-14(12-16(15)24)32-20(33)2-1-6-21(32)7-10-30(11-8-21)18-5-9-31-19(28-18)13-17(29-31)22(25,26)27/h3-5,9,12-13H,1-2,6-8,10-11H2 CHFQGGSVHSVPSS-UHFFFAOYSA-N 609846 US11708366, Example 5 Leukotriene C4 synthase Homo sapiens 5000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609846 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609846&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778398 483620015 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299278 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1noc(n1)[C@@H]1C[C@H]1C(F)(F)F |r| InChI=1S/C21H21ClF4N4O2/c22-15-4-3-12(10-16(15)23)30-17(31)2-1-5-20(30)6-8-29(9-7-20)19-27-18(32-28-19)13-11-14(13)21(24,25)26/h3-4,10,13-14H,1-2,5-9,11H2 GEHDYYRGGQVYBY-UHFFFAOYSA-N 609858 1-(4-chloro-3-fluorophenyl)-9-(5-((1R,2R)-2-(trifluoromethyl)cyclopropyl)-1,2,4-oxadiazol-3-yl)-1,9-diazaspiro[5.5]undecan-2-one, or 1-(4-chloro-3-fluorophenyl)-9-(5-((1S,2S)-2-(trifluoromethyl)cyclopropyl)-1,2,4-oxadiazol-3-yl)-1,9-diazaspiro[5.5]undecan-2-one and::US11708366, Example 6a Leukotriene C4 synthase Homo sapiens 190000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609858 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609858&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778421 483620027 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299279 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1noc(n1)[C@H]1C[C@@H]1C(F)(F)F |r| InChI=1S/C21H21ClF4N4O2/c22-15-4-3-12(10-16(15)23)30-17(31)2-1-5-20(30)6-8-29(9-7-20)19-27-18(32-28-19)13-11-14(13)21(24,25)26/h3-4,10,13-14H,1-2,5-9,11H2 GEHDYYRGGQVYBY-UHFFFAOYSA-N 609868 US11708366, Example 6b Leukotriene C4 synthase Homo sapiens 44000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609868 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609868&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778574 483620037 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299280 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1noc(n1)C12CC(C1)(C2)C(F)(F)F InChI=1S/C23H23ClF4N4O2/c24-15-4-3-14(10-16(15)25)32-17(33)2-1-5-22(32)6-8-31(9-7-22)19-29-18(34-30-19)20-11-21(12-20,13-20)23(26,27)28/h3-4,10H,1-2,5-9,11-13H2 KJLKWNPAPNPRIE-UHFFFAOYSA-N 609882 US11708366, Example 7 Leukotriene C4 synthase Homo sapiens 76000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609882 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609882&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778383 483620051 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299281 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nc(nnc1Cl)N1CCCC1 InChI=1S/C22H25Cl2FN6O/c23-16-6-5-15(14-17(16)25)31-18(32)4-3-7-22(31)8-12-29(13-9-22)20-19(24)27-28-21(26-20)30-10-1-2-11-30/h5-6,14H,1-4,7-13H2 PKSMRBWNQHUTFN-UHFFFAOYSA-N 609895 US11708366, Example 8 Leukotriene C4 synthase Homo sapiens 7000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609895 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609895&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778496 483620063 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299282 Cn1cc(nc(N2CCC3(CCCC(=O)N3c3ccc(Cl)c(F)c3)CC2)c1=O)-c1ccc(F)cc1 InChI=1S/C26H25ClF2N4O2/c1-31-16-22(17-4-6-18(28)7-5-17)30-24(25(31)35)32-13-11-26(12-14-32)10-2-3-23(34)33(26)19-8-9-20(27)21(29)15-19/h4-9,15-16H,2-3,10-14H2,1H3 OQUIYPYNWJYOJC-UHFFFAOYSA-N 609905 US11708366, Example 9 Leukotriene C4 synthase Homo sapiens 2000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609905 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609905&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778396 483620073 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299283 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nncc(n1)C1CCCC1 InChI=1S/C23H27ClFN5O/c24-18-8-7-17(14-19(18)25)30-21(31)6-3-9-23(30)10-12-29(13-11-23)22-27-20(15-26-28-22)16-4-1-2-5-16/h7-8,14-16H,1-6,9-13H2 LXUDOPFEWWNEOO-UHFFFAOYSA-N 609938 US11708366, Example 20 Leukotriene C4 synthase Homo sapiens 12000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609938 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609938&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778494 483620106 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299284 Fc1ccc(cc1)-c1cnc(o1)N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1 InChI=1S/C24H22ClF2N3O2/c25-19-8-7-18(14-20(19)27)30-22(31)2-1-9-24(30)10-12-29(13-11-24)23-28-15-21(32-23)16-3-5-17(26)6-4-16/h3-8,14-15H,1-2,9-13H2 ILWDTUKESNZLHX-UHFFFAOYSA-N 609946 US11708366, Example 21 Leukotriene C4 synthase Homo sapiens 4000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609946 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609946&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778541 483620114 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299285 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nnn(n1)-c1ccccc1 InChI=1S/C22H22ClFN6O/c23-18-9-8-17(15-19(18)24)29-20(31)7-4-10-22(29)11-13-28(14-12-22)21-25-27-30(26-21)16-5-2-1-3-6-16/h1-3,5-6,8-9,15H,4,7,10-14H2 NJZQESYVAKBTFJ-UHFFFAOYSA-N 609948 US11708366, Example 22 Leukotriene C4 synthase Homo sapiens 11000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609948 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609948&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778522 483620116 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299286 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nsc(n1)N1CCC(F)(F)C1 InChI=1S/C21H23ClF3N5OS/c22-15-4-3-14(12-16(15)23)30-17(31)2-1-5-20(30)6-9-28(10-7-20)18-26-19(32-27-18)29-11-8-21(24,25)13-29/h3-4,12H,1-2,5-11,13H2 RZOFOYYKHXDHIU-UHFFFAOYSA-N 609950 US11708366, Example 23 Leukotriene C4 synthase Homo sapiens 61000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609950 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609950&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778406 483620118 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299287 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nsc(n1)N1CC(C1)C(F)(F)F InChI=1S/C21H22ClF4N5OS/c22-15-4-3-14(10-16(15)23)31-17(32)2-1-5-20(31)6-8-29(9-7-20)18-27-19(33-28-18)30-11-13(12-30)21(24,25)26/h3-4,10,13H,1-2,5-9,11-12H2 BDNZSNYLRQTVQG-UHFFFAOYSA-N 609951 US11708366, Example 24 Leukotriene C4 synthase Homo sapiens 33000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609951 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609951&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778487 483620119 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299288 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nsc(n1)N1CCCC1 InChI=1S/C21H25ClFN5OS/c22-16-6-5-15(14-17(16)23)28-18(29)4-3-7-21(28)8-12-26(13-9-21)19-24-20(30-25-19)27-10-1-2-11-27/h5-6,14H,1-4,7-13H2 VMBGYILSHRFRKH-UHFFFAOYSA-N 609953 US11708366, Example 25 Leukotriene C4 synthase Homo sapiens 62000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609953 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609953&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778411 483620121 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299289 Fc1ccc(cc1)C(=O)\N=C(/N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1)n1nnc2ccccc12 InChI=1S/C29H25ClF2N6O2/c30-22-12-11-21(18-23(22)32)37-26(39)6-3-13-29(37)14-16-36(17-15-29)28(33-27(40)19-7-9-20(31)10-8-19)38-25-5-2-1-4-24(25)34-35-38/h1-2,4-5,7-12,18H,3,6,13-17H2 RFGIGZKJGDBEQQ-UHFFFAOYSA-N 609954 US11708366, Example 26 Leukotriene C4 synthase Homo sapiens 16000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609954 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609954&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778489 483620122 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299290 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ncc(o1)C1CCCCC1 InChI=1S/C24H29ClFN3O2/c25-19-9-8-18(15-20(19)26)29-22(30)7-4-10-24(29)11-13-28(14-12-24)23-27-16-21(31-23)17-5-2-1-3-6-17/h8-9,15-17H,1-7,10-14H2 NKCYZGVNRNUJIU-UHFFFAOYSA-N 609955 US11708366, Example 27 Leukotriene C4 synthase Homo sapiens 25000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609955 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609955&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778518 483620123 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299291 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nnc(o1)-c1ccccc1 InChI=1S/C23H22ClFN4O2/c24-18-9-8-17(15-19(18)25)29-20(30)7-4-10-23(29)11-13-28(14-12-23)22-27-26-21(31-22)16-5-2-1-3-6-16/h1-3,5-6,8-9,15H,4,7,10-14H2 HGSHKUZGANIMEW-UHFFFAOYSA-N 609956 US11708366, Example 28 Leukotriene C4 synthase Homo sapiens 110000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609956 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609956&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778485 483620124 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299292 Fc1ccc(cc1)-n1cc(nn1)N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1 InChI=1S/C23H22ClF2N5O/c24-19-8-7-18(14-20(19)26)31-22(32)2-1-9-23(31)10-12-29(13-11-23)21-15-30(28-27-21)17-5-3-16(25)4-6-17/h3-8,14-15H,1-2,9-13H2 NUPLUQSKPYORQJ-UHFFFAOYSA-N 609958 US11708366, Example 29 Leukotriene C4 synthase Homo sapiens 57000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609958 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609958&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778376 483620126 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299293 Fc1ccc(cc1)-n1ccc(n1)N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1 InChI=1S/C24H23ClF2N4O/c25-20-8-7-19(16-21(20)27)31-23(32)2-1-10-24(31)11-14-29(15-12-24)22-9-13-30(28-22)18-5-3-17(26)4-6-18/h3-9,13,16H,1-2,10-12,14-15H2 SMJOAHDDTIXRKF-UHFFFAOYSA-N 609959 US11708366, Example 30 Leukotriene C4 synthase Homo sapiens 13000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609959 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609959&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778478 483620127 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299294 Fc1ccc(cc1)-n1ncc(n1)N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1 InChI=1S/C23H22ClF2N5O/c24-19-8-7-18(14-20(19)26)30-22(32)2-1-9-23(30)10-12-29(13-11-23)21-15-27-31(28-21)17-5-3-16(25)4-6-17/h3-8,14-15H,1-2,9-13H2 XFUSXAFEOIJADX-UHFFFAOYSA-N 609960 US11708366, Example 31 Leukotriene C4 synthase Homo sapiens 15000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609960 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609960&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778426 483620128 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299295 Fc1ccc(cc1)-c1cccc(n1)N1CCC2(CCCC(=O)N2c2ccc(Cl)cc2)CC1 InChI=1S/C26H25ClFN3O/c27-20-8-12-22(13-9-20)31-25(32)5-2-14-26(31)15-17-30(18-16-26)24-4-1-3-23(29-24)19-6-10-21(28)11-7-19/h1,3-4,6-13H,2,5,14-18H2 PBNLACXCLPDZOZ-UHFFFAOYSA-N 609961 US11708366, Example 32 Leukotriene C4 synthase Homo sapiens 7000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609961 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609961&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778556 483620129 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299296 [O-][n+]1ccc(cc1N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1)-c1ccc(F)cc1 InChI=1S/C26H24ClF2N3O2/c27-22-8-7-21(17-23(22)29)32-25(33)2-1-10-26(32)11-14-30(15-12-26)24-16-19(9-13-31(24)34)18-3-5-20(28)6-4-18/h3-9,13,16-17H,1-2,10-12,14-15H2 JUOWFRPNVKMDDX-UHFFFAOYSA-N 609962 US11708366, Example 33 Leukotriene C4 synthase Homo sapiens 24000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609962 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609962&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778374 483620130 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299297 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ccnc(n1)N1CC2(CC2)C1 InChI=1S/C24H27ClFN5O/c25-18-4-3-17(14-19(18)26)31-21(32)2-1-6-24(31)9-12-29(13-10-24)20-5-11-27-22(28-20)30-15-23(16-30)7-8-23/h3-5,11,14H,1-2,6-10,12-13,15-16H2 VNZUQYWMFFRUAV-UHFFFAOYSA-N 609964 9-(2-(5-azaspiro[2.3]hexan-5-yl)pyrimidin-4-yl)-1-(4-chloro-3-fluorophenyl)-1,9-diazaspiro[5.5]undecan-2-one and::US11708366, Example 35a Leukotriene C4 synthase Homo sapiens 12000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609964 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609964&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778579 483620132 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299298 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1nccc(n1)N1CC2(CC2)C1 InChI=1S/C24H27ClFN5O/c25-18-4-3-17(14-19(18)26)31-21(32)2-1-6-24(31)9-12-29(13-10-24)22-27-11-5-20(28-22)30-15-23(16-30)7-8-23/h3-5,11,14H,1-2,6-10,12-13,15-16H2 HHVBNQFRTOKNEX-UHFFFAOYSA-N 609965 US11708366, Example 35b Leukotriene C4 synthase Homo sapiens 3000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609965 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609965&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778409 483620133 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299299 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ncnc(N2CCCC2)c1F InChI=1S/C23H26ClF2N5O/c24-17-6-5-16(14-18(17)25)31-19(32)4-3-7-23(31)8-12-30(13-9-23)22-20(26)21(27-15-28-22)29-10-1-2-11-29/h5-6,14-15H,1-4,7-13H2 RRLXZEQYEPDEGL-UHFFFAOYSA-N 609966 US11708366, Example 36 Leukotriene C4 synthase Homo sapiens 6000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609966 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609966&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778551 483620134 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299300 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ncnc(N2CC(C2)C(F)(F)F)c1F InChI=1S/C23H23ClF5N5O/c24-16-4-3-15(10-17(16)25)34-18(35)2-1-5-22(34)6-8-32(9-7-22)20-19(26)21(31-13-30-20)33-11-14(12-33)23(27,28)29/h3-4,10,13-14H,1-2,5-9,11-12H2 BSBWVOWLRJERBS-UHFFFAOYSA-N 609968 US11708366, Example 37 Leukotriene C4 synthase Homo sapiens 12000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609968 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609968&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778390 483620136 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299301 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1ncnc(n1)N1CCCC1 InChI=1S/C22H26ClFN6O/c23-17-6-5-16(14-18(17)24)30-19(31)4-3-7-22(30)8-12-29(13-9-22)21-26-15-25-20(27-21)28-10-1-2-11-28/h5-6,14-15H,1-4,7-13H2 AQAPQEDOHYEFOU-UHFFFAOYSA-N 609970 US11708366, Example 38 Leukotriene C4 synthase Homo sapiens 8000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609970 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609970&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778361 483620138 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299302 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1cc(ncn1)N1CC(F)(F)C(F)(F)C1 InChI=1S/C23H23ClF5N5O/c24-16-4-3-15(10-17(16)25)34-20(35)2-1-5-21(34)6-8-32(9-7-21)18-11-19(31-14-30-18)33-12-22(26,27)23(28,29)13-33/h3-4,10-11,14H,1-2,5-9,12-13H2 ZSFYMWKCCFMMSQ-UHFFFAOYSA-N 609971 US11708366, Example 44 Leukotriene C4 synthase Homo sapiens 13000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609971 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609971&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778516 483620139 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299303 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1cc(OCC(F)(F)F)ccn1 InChI=1S/C22H22ClF4N3O2/c23-17-4-3-15(12-18(17)24)30-20(31)2-1-6-21(30)7-10-29(11-8-21)19-13-16(5-9-28-19)32-14-22(25,26)27/h3-5,9,12-13H,1-2,6-8,10-11,14H2 ZOBUPYWZRGRRSD-UHFFFAOYSA-N 609972 US11708366, Example 81 Leukotriene C4 synthase Homo sapiens 13000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609972 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609972&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778552 483620140 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299304 c1cc(c(cc1N2C(=O)CCCC23CCN(CC3)c4cc(ncn4)OCC(F)(F)F)F)F InChI=1S/C21H21F5N4O2/c22-15-4-3-14(10-16(15)23)30-19(31)2-1-5-20(30)6-8-29(9-7-20)17-11-18(28-13-27-17)32-12-21(24,25)26/h3-4,10-11,13H,1-2,5-9,12H2 AQDBIXQGLAUSIM-UHFFFAOYSA-N 609973 US11708366, Example 82 Leukotriene C4 synthase Homo sapiens 12000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609973 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609973&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search A1IHO 9G0V 162778515 483620141 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299305 Fc1cc(ccc1Cl)N1C(=O)CCCC11CCN(CC1)c1cc(OCC(F)(F)F)ncn1 InChI=1S/C21H21ClF4N4O2/c22-15-4-3-14(10-16(15)23)30-19(31)2-1-5-20(30)6-8-29(9-7-20)17-11-18(28-13-27-17)32-12-21(24,25)26/h3-4,10-11,13H,1-2,5-9,12H2 XFNOBGBFOXWYDG-UHFFFAOYSA-N 609976 US11708366, Example 83 Leukotriene C4 synthase Homo sapiens 9000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609976 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609976&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778388 483620144 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 1299306 FC(F)COc1cc(ncn1)N1CCC2(CCCC(=O)N2c2ccc(Cl)c(F)c2)CC1 InChI=1S/C21H22ClF3N4O2/c22-15-4-3-14(10-16(15)23)29-20(30)2-1-5-21(29)6-8-28(9-7-21)18-11-19(27-13-26-18)31-12-17(24)25/h3-4,10-11,13,17H,1-2,5-9,12H2 OKXGXEKEVXGYTA-UHFFFAOYSA-N 609977 US11708366, Example 84 Leukotriene C4 synthase Homo sapiens 8000 US Patent 10.7270/Q2959NPC aid1919591 US11708366 Bushaboina, M; Chen, X; Cheung, AK; Culshaw, AJ; Hurley, TB; Labbe-Giguere, N; Miltz, W; Orain, D; Patel, T; Rajagopalan, S; Roehn, T; Sandham, DA; Thoma, G; Tichkule, RB; Walchli, R 7/25/2023 8/27/2023 Novartis http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=609977 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=609977&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 162778548 483620145 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 3PCV,3B29,2PNO,4JCZ,4J7Y,4J7T,3HKK,2UUI,2UUH,9G1T,9G14,9G0V,9G0U,6R7D,4NTF,4NTB,4NTA Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18