BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
1225260	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(COP(O)(=O)OC1C2O)OC(C3O)c1cnc2c(N)nccn12			581007	US11492367, Compound 1	Stimulator of interferon genes protein	Human		 7310							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581007	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581007&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594439	475726838							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225261	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(COP(O)(=O)OC1C2O)OC(C3O)c1cnc2c(N)nccn12			581007	US11492367, Compound 1	Stimulator of interferon genes protein	Human			 120						US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581007	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581007&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594439	475726838							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225262	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(COP(O)(=O)OC1C2O)OC(C3O)c1cnc2c(N)nccn12			581007	US11492367, Compound 1	Stimulator of interferon genes protein [138-378]	Mouse		 200000							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581007	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1061&target=Stimulator+of+interferon+genes+protein+%5B138-378%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581007&enzyme=Stimulator+of+interferon+genes+protein+%5B138-378%5D&column=ki&startPg=0&Increment=50&submit=Search			166594439	475726838							1	LTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI	4JC5,4KBY,4KC0,4YP1,5GS5,6XNN	Stimulator of interferon genes protein	STING_MOUSE	Q3TBT3	A7YGY9 Q3TAV5 Q3TYP5 Q3TZY8 Q3UJW3 Q8C227 Q8C5Q3 Q8K393 Q9CZY7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225263	CNc1ncnc2c(cnn12)C1OC2COP(O)(=O)OC3C(O)C(COP(O)(=O)OC2C1O)OC3n1cnc2c1nc(N)[nH]c2=O			581008	US11492367, Compound 2	Stimulator of interferon genes protein	Human		 56700							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581008	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581008&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594440	475726839							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225264	CNc1ncnc2c(cnn12)C1OC2COP(O)(=O)OC3C(O)C(COP(O)(=O)OC2C1O)OC3n1cnc2c1nc(N)[nH]c2=O			581008	US11492367, Compound 2	Stimulator of interferon genes protein	Human			 120						US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581008	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581008&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594440	475726839							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225265	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3cnc4c(N)ncnc34)CO[P@](S)(=O)O[C@@H]1[C@@H]2CO			581009	US11492367, Compound 5	Stimulator of interferon genes protein	Human		 1830							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581009	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581009&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594441	475726840							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225266	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3cnc4c(N)ncnc34)CO[P@](S)(=O)O[C@@H]1[C@@H]2CO			581010	US11492367, Compound 6	Stimulator of interferon genes protein	Human		 61.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581010	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581010&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594441	475726841							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225267	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3cnc4c(N)ncnc34)CO[P@@](S)(=O)O[C@@H]1[C@@H]2CO			581011	US11492367, Compound 7	Stimulator of interferon genes protein	Human		<10.00							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581011	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581011&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594441	475726842							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225268	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3cnc4c(N)ncnc34)CO[P@@](S)(=O)O[C@@H]1[C@@H]2CO			581012	US11492367, Compound 8	Stimulator of interferon genes protein	Human		 270							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581012	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581012&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594441	475726843							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225269	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2COP(O)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3ccc4c(N)ncnc34)COP(O)(=O)O[C@@H]1[C@@H]2CO			581014	US11492367, Compound 9	Stimulator of interferon genes protein	Human		 960							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581014	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581014&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594443	475726845							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225270	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3ccc4c(N)ncnc34)CO[P@@](S)(=O)O[C@@H]1[C@@H]2CO			581015	US11492367, Compound 10	Stimulator of interferon genes protein	Human		 6690							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581015	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581015&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594444	475726846							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225271	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3ccc4c(N)ncnc34)CO[P@](S)(=O)O[C@@H]1[C@@H]2CO			581016	US11492367, Compound 11	Stimulator of interferon genes protein	Human		 2460							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581016	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581016&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594444	475726847							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225272	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3ccc4c(N)ncnc34)CO[P@@](S)(=O)O[C@@H]1[C@@H]2CO			581017	US11492367, Compound 12	Stimulator of interferon genes protein	Human		 270							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581017	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581017&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594444	475726848							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225273	Nc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2CO[P@](S)(=O)O[C@@H]3[C@H](C[C@H]([C@@H]3O)n3ccc4c(N)ncnc34)CO[P@](S)(=O)O[C@@H]1[C@@H]2CO			581018	US11492367, Compound 13	Stimulator of interferon genes protein	Human		 42.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581018	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581018&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594444	475726849							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225274	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)NC3CC(OC3COP(O)(=O)OC1C2O)n1cnc2c(N)ncnc12			581019	US11492367, Compound 17	Stimulator of interferon genes protein	Human		 38.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581019	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581019&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594445	475726850							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225275	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)NC3CC(OC3COP(O)(=O)OC1C2O)n1cnc2c(N)ncnc12			581019	US11492367, Compound 17	Stimulator of interferon genes protein	Human			 4.85						US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581019	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581019&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594445	475726850							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225276	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)NC3CC(OC3COP(O)(=O)OC1C2O)n1cnc2c(N)ncnc12			581019	US11492367, Compound 17	Stimulator of interferon genes protein [138-378]	Mouse		<10000							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581019	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1061&target=Stimulator+of+interferon+genes+protein+%5B138-378%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581019&enzyme=Stimulator+of+interferon+genes+protein+%5B138-378%5D&column=ki&startPg=0&Increment=50&submit=Search			166594445	475726850							1	LTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI	4JC5,4KBY,4KC0,4YP1,5GS5,6XNN	Stimulator of interferon genes protein	STING_MOUSE	Q3TBT3	A7YGY9 Q3TAV5 Q3TYP5 Q3TZY8 Q3UJW3 Q8C227 Q8C5Q3 Q8K393 Q9CZY7																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225277	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)NC3C(COP(O)(=O)OC1C2O)OC(C3F)n1cnc2c(N)ncnc12			581020	US11492367, Compound 18	Stimulator of interferon genes protein	Human		<10.00							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581020	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581020&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594446	475726851							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225278	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2CNP(O)(=O)OC3C(COP(O)(=O)OC1C2F)OC(C3O)n1cnc2c(N)ncnc12			581021	US11492367, Compound 24	Stimulator of interferon genes protein	Human		>100000							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581021	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581021&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594447	475726852							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225279	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(CNP(O)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581022	US11492367, Compound 25	Stimulator of interferon genes protein	Human		 85.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581022	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581022&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594448	475726853							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225280	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)NC3C(CO[P@](S)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581023	US11492367, Compound 26	Stimulator of interferon genes protein	Human		<10.00							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581023	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581023&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594449	475726854							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225281	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)NC3C(CO[P@@](S)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581024	US11492367, Compound 27	Stimulator of interferon genes protein	Human		 24.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581024	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581024&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594449	475726855							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225282	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2CO[P@](S)(=O)NC3C(CO[P@](S)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581025	US11492367, Compound 28	Stimulator of interferon genes protein	Human		 61.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581025	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581025&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594450	475726856							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225283	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2CO[P@](S)(=O)NC3C(CO[P@@](S)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581026	US11492367, Compound 29	Stimulator of interferon genes protein	Human		<10.00							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581026	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581026&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594450	475726857							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225284	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2CO[P@@](S)(=O)NC3C(CO[P@@](S)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581027	US11492367, Compound 30	Stimulator of interferon genes protein	Human		 11.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581027	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581027&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594450	475726858							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225285	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2CO[P@@](S)(=O)NC3C(CO[P@](S)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581028	US11492367, Compound 31	Stimulator of interferon genes protein	Human		<10.00							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581028	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581028&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594450	475726859							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225286	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2CO[P@](S)(=O)OC3C(CCP(O)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581029	US11492367, Compound 32	Stimulator of interferon genes protein	Human		 34.0							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581029	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581029&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594451	475726860							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1225287	Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(COP(O)(=O)NC1C2CO)OC(C3F)n1cnc2c(N)ncnc12			581030	US11492367, Compound 33	Stimulator of interferon genes protein	Human		<10.00							US Patent		10.7270/Q2B2805P			US11492367	Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G; Schepens, W; Viellevoye, M; Thuring, JW	11/8/2022	1/20/2023	Janssen Biotech, Inc.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=581030	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=905&target=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=581030&enzyme=Stimulator+of+interferon+genes+protein&column=ki&startPg=0&Increment=50&submit=Search			166594452	475726861							1	MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS	4EF4,4EF5,4F9E,4F9G,6YWA,7SII,7T9U,7T9V,7X9P,7X9Q,8GT6	Stimulator of interferon genes protein	STING_HUMAN	Q86WV6	A8K3P6 B6EB35 D6RBX0 D6RE01 D6RID9