BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
1160862	Fc1c(ccnc1C(F)(F)F)C(=O)N1CCC(CC1)N1CC(CC#N)(C1)n1cc(cn1)-c1ncnc2[nH]ccc12	InChI=1S/C26H23F4N9O/c27-20-18(1-7-32-22(20)26(28,29)30)24(40)37-9-3-17(4-10-37)38-13-25(14-38,5-6-31)39-12-16(11-36-39)21-19-2-8-33-23(19)35-15-34-21/h1-2,7-8,11-12,15,17H,3-5,9-10,13-14H2,(H,33,34,35)	KTBSXLIQKWEBRB-UHFFFAOYSA-N	246868	US10053465, 7::US10065963, Compound 7::US10125150, Example 7::US10336759, # 7::US10479803, Example 7::US10519163, Example 7::US10675284, Example 7::US10875847, Compound INCB39110::US11084822, Example 7::US11130767, # 7::US11136326, Example 7::US11285140, Example 364::US11304949, Compound 1::US11324749, Comp. No. 1::US11406640, Comp. No. 1::US11596632, Comp. No. 1::US9732097, Example 7::US9999619, Example 364::{1-{1-[3-Fluoro-2- (trifluoromethyl) isonicotinoyl] piperidin-4- yl}-3-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-3- yl}acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246868	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246868&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			53380437	376222443							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160863	Fc1ccc(NC(=O)N2CCC(CC2)N2CC(CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)c(c1)C(F)(F)F	InChI=1S/C27H25F4N9O/c28-18-1-2-22(21(11-18)27(29,30)31)37-25(41)38-9-4-19(5-10-38)39-14-26(15-39,6-7-32)40-13-17(12-36-40)23-20-3-8-33-24(20)35-16-34-23/h1-3,8,11-13,16,19H,4-6,9-10,14-15H2,(H,37,41)(H,33,34,35)	RZUCZMLSGAQMJN-UHFFFAOYSA-N	246869	4-{3-(Cyanomethyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-1-yl}-N- [4-fluoro-2- (trifluoromethyl) phenyl]piperidine-1- carboxamide::US10053465, 8::US10065963, Compound 8::US10125150, Example 8::US10336759, # 8::US10479803, Example 8::US10519163, Example 8::US10675284, Example 8::US11084822, Example 8::US11130767, # 8::US11136326, Example 8::US11285140, Example 154::US11304949, Compound 2::US11324749, Comp. No. 2::US11406640, Comp. No. 2::US11596632, Comp. No. 2::US9732097, Example 8::US9999619, Example 154	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246869	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246869&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			58431300	376222444							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160864	FC(F)(F)c1nccc(n1)C(=O)N1CCC(CC1)N1CC(CC#N)(C1)n1cc(cn1)-c1ncnc2[nH]ccc12	InChI=1S/C25H23F3N10O/c26-25(27,28)23-31-8-2-19(35-23)22(39)36-9-3-17(4-10-36)37-13-24(14-37,5-6-29)38-12-16(11-34-38)20-18-1-7-30-21(18)33-15-32-20/h1-2,7-8,11-12,15,17H,3-5,9-10,13-14H2,(H,30,32,33)	QFPGZAJRDFHPCE-UHFFFAOYSA-N	246870	US10053465, 9::US10065963, Compound 9::US10125150, Example 9::US10336759, # 9::US10479803, Example 9::US10675284, Example 9::US11084822, Example 9::US11130767, # 9::US11136326, Example 9::US11285140, Example 85::US11304949, Compound 3::US11324749, Comp. No. 3::US11406640, Comp. No. 3::US11596632, Comp. No. 3::US9732097, Example 9::US9999619, Example 86::[3-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1-yl]-1- (1-{[2- (trifluoromethyl) pyrimidin-4- yl]carbonyl} piperidin-4-yl) azetidin-3- yl]acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246870	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246870&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			67391950	376222445							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160865	C[C@H](NC(=O)c1cc(F)c(cc1F)N1CC(CC#N)(C1)n1cc(cn1)-c1c(C)n[nH]c1C)C(F)(F)F			246853	4-[3-(cyanomethyl)- 3-(3&#39;,5&#39;-dimethyl- 1H,1&#39;H-4,4&#39;- bipyrazol-1- yl)azetidin-1-yl]-2,5- difluoro-N-[(1S)- 2,2,2-trifluoro-1- methylethyl] benzamide::US10053465, 2::US10065963, Compound 2::US10125150, Example 2::US10336759, # 2::US10435392, Example 17::US10479803, Example 2D::US10519163, Example 2::US10675284, Example 2::US11084822, Example 2::US11130767, # 2::US11136326, Example 2::US11304949, Compound 4::US11324749, Comp. No. 4::US11591318, Example 7::US11596632, Comp. No. 4::US9732097, Example 2::US9926301, Example 17	Tyrosine-protein kinase JAK1 [837-1142]	Human		<300							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246853	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246853&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			134823366	376222428							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160866	C[C@@H](O)c1nc2cnc3ccsc3c2n1[C@H]1CC[C@H](CC#N)OC1	InChI=1S/C17H18N4O2S/c1-10(22)17-20-14-8-19-13-5-7-24-16(13)15(14)21(17)11-2-3-12(4-6-18)23-9-11/h5,7-8,10-12,22H,2-4,9H2,1H3/t10-,11+,12-/m1/s1	YMFIMTJNSGCVCV-GRYCIOLGSA-N	246852	((2R,5S)-5-{2-[(1R)- 1-hydroxyethyl]-1H- imidazo[4,5- d]thieno[3,2- b]pyridin-1- yl}tetrahydro-2H- pyran-2- yl)acetonitrile::US10053465, 1::US10065963, Compound 1::US10125150, Example 1::US10370387, Example 20::US10479803, Example 1D::US10519163, Example 1::US10675284, Example 1::US11084822, Example 1::US11130767, # 1::US11161855, Example 20::US11304949, Compound 5::US11324749, Comp. No. 5::US11406640, Comp. No. 5::US11596632, Comp. No. 5::US9732097, Example 1::US9777017, Example 20::US9908895, Example 20	Tyrosine-protein kinase JAK1 [837-1142]	Human		<100							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246852	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246852&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			73776047	376222427							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160867	Clc1cccc(n1)N1CCC(C1)C(CC#N)n1cc(cn1)-c1ncnc2[nH]ccc12			246861	3-[1-(6- chloropyridin-2- yl)pyrrolidin-3-yl]-3- [4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]propanenitrile::US10005788, 2 (2nd peak, cis-)::US10053465, 3::US10065963, Compound 3::US10125150, Example 3::US10336759, # 3::US10479803, Example 3::US10519163, Example 3::US10675284, Example 3::US11084822, Example 3::US11130767, # 3::US11136326, Example 3::US11304949, Compound 6::US11324749, Comp. No. 6::US11406640, Comp. No. 6::US11596632, Comp. No. 6::US9732097, Example 3	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246861	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246861&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			49819434	376222436							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160868	N#CCC(C1CCN(C1)c1nc2cccnc2o1)n1cc(cn1)-c1ncnc2[nH]ccc12			246864	3-(1- [1,3]oxazolo[5,4- b]pyridin-2- ylpyrrolidin-3-yl)-3- [4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]propanenitrile::US10053465, 4::US10065963, Compound 4::US10125150, Example 4::US10336759, # 4::US10479803, Example 4::US10519163, Example 4::US10675284, Example 4::US11084822, Example 4::US11130767, # 4::US11136326, Example 4::US11304949, Compound 7::US11324749, Comp. No. 7::US11406640, Comp. No. 7::US11596632, Comp. No. 7::US9732097, Example 4	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246864	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246864&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			49819709	376222439							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160869	Fc1cc(ccc1C(=O)N1CCN(CC(CC#N)n2cc(cn2)-c2ncnc3[nH]ccc23)CC1)C#N			285696	4-[(4-{3-cyano-2-[3- (7H-pyrrolo[2,3- d]pyrimidin-4-yl)-1H- pyrrol-1- yl]propyl}piperazin-1- yl)carbonyl]-3- fluorobenzonitrile::US10077277, Example 6::US10336759, # 5::US10479803, Example 5::US10519163, Example 5::US10675284, Example 5::US11130767, # 5::US11136326, Example 5::US11304949, Compound 8::US11324749, Comp. No. 8::US11406640, Comp. No. 8::US9732097, Example 5	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=285696	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=285696&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			50995828	378169335							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160870	Fc1cc(ccc1C(=O)N1CCN(CC(CC#N)n2ccc(c2)-c2ncnc3[nH]ccc23)CC1)C#N			246867	4-[(4-{3-cyano-2-[3- (7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrrol-1- yl]propyl}piperazin- 1-yl)carbonyl]-3- fluorobenzonitrile::US10053465, 6::US10065963, Compound 6::US10125150, Example 6::US10336759, # 6::US10479803, Example 6::US10519163, Example 6::US10675284, Example 6::US11084822, Example 6::US11130767, # 6::US11136326, Example 6::US11304949, Compound 9::US11324749, Comp. No. 9::US11406640, Comp. No. 9::US11596632, Comp. No. 9::US9732097, Example 6	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246867	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246867&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			50995829	376222442							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160871	FC(F)(F)c1nccc(n1)C(=O)N1CCN(CC1)[C@H]1C[C@@](CC#N)(C1)n1cc(cn1)-c1ncnc2[nH]ccc12			246871	US10053465, 10::US10065963, Compound 10::US10125150, Example 10::US10336759, # 10::US10479803, Example 10::US10519163, Example 10::US10675284, Example 10::US11084822, Example 10::US11130767, # 10::US11136326, Example 10::US11304949, Compound 10::US11324749, Comp. No. 10::US11406640, Comp. No. 10::US11596632, Comp. No. 10::US9732097, Example 10::[trans-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1-yl]-3- (4-{[2- (trifluoromethyl) pyrimidin-4- yl]carbonyl} piperazin-1- yl)cyclobutyl] acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246871	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246871&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			69675180	376222446							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160872	OC1CN(Cc2cc(OC3CCN(CC3)[C@H]3C[C@@](CC#N)(C3)n3cc(cn3)-c3ncnc4[nH]ccc34)nc(c2)C(F)(F)F)C1			246872	US10053465, 11::US10065963, Compound 11::US10125150, Example 11::US10336759, # 11::US10479803, Example 11::US10519163, Example 11::US10675284, Example 11::US11084822, Example 11::US11130767, # 11::US11136326, Example 11::US11304949, Compound 11::US11324749, Comp. No. 11::US11406640, Comp. No. 11::US11596632, Comp. No. 11::US9732097, Example 11::{trans-3-(4-{[4-[(3- hydroxyazetidin-1- yl)methyl]-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cydobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246872	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246872&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			67954748	376222447							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160873	OC[C@@H]1CCCN1Cc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246873	US10053465, 12::US10065963, Compound 12::US10125150, Example 12::US10336759, # 12::US10479803, Example 12::US10519163, Example 12::US10675284, Example 12::US11084822, Example 12::US11130767, # 12::US11136326, Example 12::US11304949, Compound 12::US11324749, Comp. No. 12::US11406640, Comp. No. 12::US11596632, Comp. No. 12::US9732097, Example 12::{trans-3-(4-{[4- {[(2S)-2- (hydroxymethyl) pyrrolidin-1-yl] methyl}-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246873	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246873&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			67954458	376222448							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160874	OC[C@H]1CCCN1Cc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246874	US10053465, 13::US10065963, Compound 13::US10125150, Example 13::US10336759, # 13::US10479803, Example 13::US10675284, Example 13::US11084822, Example 13::US11130767, # 13::US11136326, Example 13::US11304949, Compound 13::US11324749, Comp. No. 13::US11406640, Comp. No. 13::US11596632, Comp. No. 13::US9732097, Example 13::{trans-3-(4-{[4- {[(2R)-2- (hydroxymethyl) pyrrolidin-1-yl] methyl}-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246874	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246874&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			67954694	376222449							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160875	CN(C)Cc1cc(F)cc(OC2CCN(CC(CC#N)n3cc(cn3)-c3ncnc4[nH]ccc34)CC2)c1			246875	4-(4-{3- [(dimethylamino) methyl]-5- fluorophenoxy} piperidin-1-yl)-3- [4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]butanenitrile::BDBM596391::US10053465, 14::US10065963, Compound 14::US10125150, Example 14::US10336759, # 14::US10479803, Example 14::US10675284, Example 14::US11084822, Example 14::US11130767, # 14::US11136326, Example 14::US11304949, Compound 14::US11324749, Comp. No. 14::US11406640, Comp. No. 14::US9732097, Example 14	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246875	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246875&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			69675055	376222450							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160876	CC(C)NC(=O)c1cnc(cn1)N1CC(CC#N)(C1)n1cc(cn1)-c1ncnc2[nH]ccc12	InChI=1S/C22H22N10O/c1-14(2)30-21(33)17-8-26-18(9-25-17)31-11-22(12-31,4-5-23)32-10-15(7-29-32)19-16-3-6-24-20(16)28-13-27-19/h3,6-10,13-14H,4,11-12H2,1-2H3,(H,30,33)(H,24,27,28)	NQSJETFQTIKWPX-UHFFFAOYSA-N	246876	5-{3-(cyanomethyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-1-yl}-N- isopropylpyrazine-2- carboxamide::US10053465, 15::US10053465, 17::US10065963, Compound 15::US10125150, Example 15::US10336759, # 15::US10479803, Example 15::US10513522, Example 18::US10675284, Example 15::US11084822, Example 15::US11130767, # 15::US11136326, Example 15::US11214573, Example 18::US11304949, Compound 15::US11324749, Comp. No. 15::US11406640, Comp. No. 15::US9611269, Example 18::US9732097, Example 15	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246876	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246876&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71143618	376222451							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160877	C[C@H](NC(=O)c1cc(F)c(cc1F)N1CC(CC#N)(C1)n1cc(cn1)-c1ncnc2[nH]ccc12)C(F)(F)F			246877	4-{3-(cyanomethyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-1-yl}-2,5- difluoro-N-[(1S)- 2,2,2-trifluoro-1- methylethyl] benzamide::US10053465, 16::US10065963, Compound 16::US10125150, Example 16::US10336759, # 16::US10479803, Example 16::US10519163, Example 16::US10675284, Example 16::US11084822, Example 16::US11130767, # 16::US11136326, Example 16::US11214573, Example 28::US11304949, Compound 16::US11324749, Comp. No. 16::US11406640, Comp. No. 16::US9611269, Example 28::US9732097, Example 16	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246877	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246877&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71155374	376222452							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160878	CC(C)NC(=O)c1cnc(cn1)N1CC(CC#N)(C1)n1cc(cn1)-c1ccnc2[nH]ccc12	InChI=1S/C23H23N9O/c1-15(2)30-22(33)19-10-28-20(11-27-19)31-13-23(14-31,5-6-24)32-12-16(9-29-32)17-3-7-25-21-18(17)4-8-26-21/h3-4,7-12,15H,5,13-14H2,1-2H3,(H,25,26)(H,30,33)	MDDZCYJCJQHUCB-UHFFFAOYSA-N	262166	5-{3-(cyanomethyl)- 3-[4-(1H-pyrrolo[2,3- b]pyridin-4-yl)-1H- pyrazol-1-yl] azetidin-1-yl}-N- isopropylpyrazine- 2-carboxamide::US10065963, Compound 17::US10125150, Example 17::US10336759, # 17::US10479803, Example 17::US10513522, Example 34::US10675284, Example 17::US11084822, Example 17::US11130767, # 17::US11136326, Example 17::US11214573, Example 34::US11304949, Compound 17::US11324749, Comp. No. 17::US11406640, Comp. No. 17::US11596632, Comp. No. 17::US9611269, Example 34::US9708333, 17::US9732097, Example 17	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=262166	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=262166&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71143600	376223994							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160879	OCCc1cc(O[C@H]2CC[C@H](CC2)N2CC(CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(n1)C(F)(F)F			246879	US10053465, 18::US10065963, Compound 18::US10125150, Example 18::US10336759, # 18::US10479803, Example 18::US10519163, Example 18::US10675284, Example 18::US11084822, Example 18::US11130767, # 18::US11136326, Example 18::US11304949, Compound 18::US11324749, Comp. No. 18::US11406640, Comp. No. 18::US11596632, Comp. No. 18::US9732097, Example 18::{1-(cis-4-{[6-(2- hydroxyethyl)-2- (trifluoromethyl) pyrimidin-4- yl]oxy}cyclohexyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-3- yl}acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246879	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246879&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71257515	376222453							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160880	CCNCc1cc(O[C@H]2CC[C@H](CC2)N2CC(CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246880	US10053465, 19::US10065963, Compound 19::US10125150, Example 19::US10336759, # 19::US10479803, Example 19::US10519163, Example 19::US10675284, Example 19::US11084822, Example 19::US11130767, # 19::US11136326, Example 19::US11304949, Compound 19::US11324749, Comp. No. 19::US11406640, Comp. No. 19::US11596632, Comp. No. 19::US9732097, Example 19::{1-(cis-4-{[4- [(ethylamino) methyl]-6- (trifluoromethyl) pyridin-2- yl]oxy}cyclohexyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-3- yl}acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246880	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246880&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71257549	376222454							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160881	CC(C)(O)c1cc(O[C@H]2CC[C@H](CC2)N2CC(CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246881	US10053465, 20::US10065963, Compound 20::US10125150, Example 20::US10336759, # 20::US10479803, Example 20::US10519163, Example 20::US10675284, Example 20::US11084822, Example 20::US11130767, # 20::US11136326, Example 20::US11304949, Compound 20::US11324749, Comp. No. 20::US11406640, Comp. No. 20::US11596632, Comp. No. 20::{1-(cis-4-{[4-(1- hydroxy-1- methylethyl)-6- (trifluoromethyl) pyridin-2- yl]oxy}cyclohexyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-3- yl}aceionitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246881	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246881&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71257490	376222455							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160882	O[C@@H]1CCN(Cc2cc(O[C@H]3CC[C@H](CC3)N3CC(CC#N)(C3)n3cc(cn3)-c3ncnc4[nH]ccc34)nc(c2)C(F)(F)F)C1			246882	US10053465, 21::US10065963, Compound 21::US10125150, Example 21::US10336759, # 21::US10519163, Example 21::US10675284, Example 21::US11084822, Example 21::US11130767, # 21::US11136326, Example 21::US11304949, Compound 21::US11324749, Comp. No. 21::US11406640, Comp. No. 21::US11596632, Comp. No. 21::US9732097, Example 21::{1-(cis-4-{[4-{[(3R)- 3-hydroxypyrrolidin- 1-yl]methyl}-6- (trifluoromethyl) pyridin-2- yl]oxy}cyclohexyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-3- yl}acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246882	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246882&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71257615	376222456							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160883	O[C@H]1CCN(Cc2cc(O[C@H]3CC[C@H](CC3)N3CC(CC#N)(C3)n3cc(cn3)-c3ncnc4[nH]ccc34)nc(c2)C(F)(F)F)C1			246883	US10005788, 1 (2nd peak, cis-)::US10053465, 22::US10065963, Compound 22::US10125150, Example 22::US10336759, # 22::US10479803, Example 22::US10519163, Example 22::US10675284, Example 22::US11084822, Example 22::US11130767, # 22::US11136326, Example 22::US11304949, Compound 22::US11324749, Comp. No. 22::US11406640, Comp. No. 22::US11596632, Comp. No. 22::US9732097, Example 22::{1-(cis-4-{[4-{[(3S)- 3-hydroxypyrrolidin- 1-yl]methyl}-6- (trifluoromethyl) pyridin-2- yl]oxy}cyclohexyl)- 3-[4-(7H-pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]azetidin-3- yl jacetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246883	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246883&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			71257290	376222457							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160884	C[C@@H](CO)NCc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246884	US10053465, 23::US10065963, Compound 23::US10125150, Example 23::US10336759, # 23::US10479803, Example 23::US10519163, Example 23::US10675284, Example 23::US11084822, Example 23::US11130767, # 23::US11136326, Example 23::US11304949, Compound 23::US11324749, Comp. No. 23::US11406640, Comp. No. 23::US11596632, Comp. No. 23::US9732097, Example 23::{trans-3-(4-{[4- ({[(1S)-2-hydroxy-1- methylethyl]amino} methyl)-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246884	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246884&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			72188552	376222458							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160885	C[C@@H](O)CNCc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246885	US10053465, 24::US10065963, Compound 25::US10125150, Example 24::US10336759, # 24::US10479803, Example 24::US10519163, Example 24::US10675284, Example 24::US11084822, Example 24::US11130767, # 24::US11136326, Example 24::US11304949, Compound 24::US11324749, Comp. No. 24::US11406640, Comp. No. 24::US11596632, Comp. No. 24::US9732097, Example 24::{trans-3-(4-{[4- ({[(2R)-2- hydroxypropyl] amino}methyl)-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246885	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246885&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			89912719	376222459							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160886	C[C@H](O)CNCc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246886	US10053465, 25::US10077277, Example 25::US10125150, Example 25::US10336759, # 25::US10479803, Example 25::US10519163, Example 25::US10675284, Example 25::US11084822, Example 25::US11130767, # 25::US11136326, Example 25::US11304949, Compound 25::US11324749, Comp. No. 25::US11406640, Comp. No. 25::US11596632, Comp. No. 25::US9732097, Example 25::{trans-5-3-(4-{[4- ({[(2S)-2- hydroxypropyl] amino}methyl)-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246886	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246886&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			89908191	376222460							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
1160887	OCCc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F			246888	US10053465, 26::US10065963, Compound 26::US10125150, Example 26::US10336759, # 26::US10479803, Example 26::US10675284, Example 26::US11084822, Example 26::US11130767, # 26::US11136326, Example 26::US11304949, Compound 26::US11324749, Comp. No. 26::US11406640, Comp. No. 26::US11596632, Comp. No. 26::US9732097, Example 26::trans-3-(4-{[4-(2- hydroxyethyl)-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile	Tyrosine-protein kinase JAK1 [837-1142]	Human		<10							US Patent		10.7270/Q2902702		aid1806452	US11304949	Howell, MD; Smith, P	4/19/2022	7/31/2022	Incyte Corporation	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=246888	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=641&target=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=246888&enzyme=Tyrosine-protein+kinase+JAK1+%5B837-1142%5D&column=ki&startPg=0&Increment=50&submit=Search			89908198	376222462							1	FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSF	3EYG,3EYH,4E4L,4E4N,4E5W,4EHZ,4EI4,4FK6,4I5C,4IVB,4IVC,4IVD,4K6Z,4K77,5E1E,5HX8,5WO4,6AAH,6ELR,6GGH,6HZU,6N77,6N78,6N79,6N7A,6N7B,6N7C,6N7D,6RSB,6RSC,6RSD,6RSE,6RSH,6SM8,6SMB,6TPE,6TPF	Tyrosine-protein kinase JAK1	JAK1_HUMAN	P23458	Q59GQ2 Q9UD26																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
