BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 1006173 O=C(CCc1c[nH]c2ccccc12)Nc1nnc([nH]1)-c1ccccn1 InChI=1S/C18H16N6O/c25-16(9-8-12-11-20-14-6-2-1-5-13(12)14)21-18-22-17(23-24-18)15-7-3-4-10-19-15/h1-7,10-11,20H,8-9H2,(H2,21,22,23,24,25) LROGMTUTBSSKQG-UHFFFAOYSA-N 485653 US10940139, Example 02471::US11000515, Compound TABLE 7.22::US11213515, TABLE 7.22::US11541041, Compound Table 7.1 GTPase KRas [G12D] Human <5000 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485653 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485653&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 47037790 444855644 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006174 CC(Oc1cccc(c1)C#N)C(=O)Nc1nnc([nH]1)-c1ccccn1 485654 US10940139, Example 02511::US11000515, Compound TABLE 7.62::US11213515, TABLE 7.62::US11541041, Compound Table 7.41 GTPase KRas [G12D] Human <5000 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485654 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485654&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 47925593 444855645 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006175 Cc1cccc(OCC(=O)Nc2nnc([nH]2)-c2ccccn2)c1 InChI=1S/C16H15N5O2/c1-11-5-4-6-12(9-11)23-10-14(22)18-16-19-15(20-21-16)13-7-2-3-8-17-13/h2-9H,10H2,1H3,(H2,18,19,20,21,22) KERLVTJVYMHOLQ-UHFFFAOYSA-N 485655 US10940139, Example 02555::US11000515, Compound TABLE 7.106::US11213515, TABLE 7.106::US11541041, Compound Table 7.85 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485655 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485655&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 51081304 444855646 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006176 O=c1nc([nH]c2c3ccccc3sc12)-c1ccccn1 InChI=1S/C15H9N3OS/c19-15-13-12(9-5-1-2-7-11(9)20-13)17-14(18-15)10-6-3-4-8-16-10/h1-8H,(H,17,18,19) ALFAOHUTKFMVBY-UHFFFAOYSA-N 485656 US10940139, Example 02592::US11000515, Compound TABLE 7.143::US11213515, TABLE 7.143::US11541041, Compound Table 7.122 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485656 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485656&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 156600921 444855647 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006177 COc1ccc(COCC(=O)N2CCCc3c(O)nc(nc23)-c2ccccn2)cc1 InChI=1S/C22H22N4O4/c1-29-16-9-7-15(8-10-16)13-30-14-19(27)26-12-4-5-17-21(26)24-20(25-22(17)28)18-6-2-3-11-23-18/h2-3,6-11H,4-5,12-14H2,1H3,(H,24,25,28) SLGPXXSXKNUFCB-UHFFFAOYSA-N 485657 US10940139, Example 02639::US11000515, Compound TABLE 7.190::US11213515, TABLE 7.190::US11541041, Compound Table 7.169 GTPase KRas [G12D] Human <5000 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485657 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485657&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137223346 444855648 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006178 CS(=O)(=O)c1cccc(c1)C(=O)N1CCCc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C20H18N4O4S/c1-29(27,28)14-7-4-6-13(12-14)20(26)24-11-5-8-15-18(24)22-17(23-19(15)25)16-9-2-3-10-21-16/h2-4,6-7,9-10,12H,5,8,11H2,1H3,(H,22,23,25) YJVZKKYAHQNFOK-UHFFFAOYSA-N 485658 US10940139, Example 02647::US11000515, Compound TABLE 7.198::US11213515, TABLE 7.198::US11541041, Compound Table 7.177 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485658 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485658&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137223378 444855649 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006179 Oc1nc(nc2c(csc12)C(=O)N1CCN(CC1)c1ccccc1)-c1ccccn1 InChI=1S/C22H19N5O2S/c28-21-19-18(24-20(25-21)17-8-4-5-9-23-17)16(14-30-19)22(29)27-12-10-26(11-13-27)15-6-2-1-3-7-15/h1-9,14H,10-13H2,(H,24,25,28) NBUHZJNQKHPLPW-UHFFFAOYSA-N 485659 US10940139, Example 02680::US11000515, Compound TABLE 7.231::US11213515, TABLE 7.231::US11541041, Compound Table 7.210 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485659 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485659&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137223309 444855650 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006180 Oc1nc(nc2sccc12)-c1ccccn1 InChI=1S/C11H7N3OS/c15-10-7-4-6-16-11(7)14-9(13-10)8-3-1-2-5-12-8/h1-6H,(H,13,14,15) CBIDWCOAELWUSK-UHFFFAOYSA-N 485660 US10940139, Example 02704::US11000515, Compound TABLE 7.255::US11213515, TABLE 7.255::US11541041, Compound Table 7.234 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485660 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485660&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 12215482 444855651 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006181 OCc1ccnc(c1)-c1nc(O)c2ccsc2n1 InChI=1S/C12H9N3O2S/c16-6-7-1-3-13-9(5-7)10-14-11(17)8-2-4-18-12(8)15-10/h1-5,16H,6H2,(H,14,15,17) NCRQMBWGOBHQSQ-UHFFFAOYSA-N 485661 US10940139, Example 02708::US11000515, Compound TABLE 7.259::US11213515, TABLE 7.259::US11541041, Compound Table 7.238 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485661 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485661&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 145769266 444855652 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006182 Oc1cccc(CN2CCN(CC2)C(=O)c2csc3c(O)nc(nc23)-c2ccccn2)c1 InChI=1S/C23H21N5O3S/c29-16-5-3-4-15(12-16)13-27-8-10-28(11-9-27)23(31)17-14-32-20-19(17)25-21(26-22(20)30)18-6-1-2-7-24-18/h1-7,12,14,29H,8-11,13H2,(H,25,26,30) STGUTZFOXAETIS-UHFFFAOYSA-N 485662 US10940139, Example 02726::US11000515, Compound TABLE 7.277::US11213515, TABLE 7.277::US11541041, Compound Table 7.256 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485662 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485662&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429626 444855653 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006183 Oc1nc(nc2c(csc12)C(=O)N1CCOC(C1)c1nccs1)-c1ccccn1 InChI=1S/C19H15N5O3S2/c25-17-15-14(22-16(23-17)12-3-1-2-4-20-12)11(10-29-15)19(26)24-6-7-27-13(9-24)18-21-5-8-28-18/h1-5,8,10,13H,6-7,9H2,(H,22,23,25) PBUGBCDQONNVCY-UHFFFAOYSA-N 485663 US10940139, Example 02734::US11000515, Compound TABLE 7.285::US11213515, TABLE 7.285::US11541041, Compound Table 7.264 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485663 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485663&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429344 444855654 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006184 CC1CN(CCN1C(=O)c1csc2c(O)nc(nc12)-c1ccccn1)c1ccccc1 InChI=1S/C23H21N5O2S/c1-15-13-27(16-7-3-2-4-8-16)11-12-28(15)23(30)17-14-31-20-19(17)25-21(26-22(20)29)18-9-5-6-10-24-18/h2-10,14-15H,11-13H2,1H3,(H,25,26,29) MSYOPFMOXXPGEN-UHFFFAOYSA-N 485664 US10940139, Example 02761::US11000515, Compound TABLE 7.312::US11213515, TABLE 7.312::US11541041, Compound Table 7.291 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485664 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485664&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429435 444855655 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006185 COc1ccccc1C1CN(CCO1)C(=O)c1csc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C23H20N4O4S/c1-30-17-8-3-2-6-14(17)18-12-27(10-11-31-18)23(29)15-13-32-20-19(15)25-21(26-22(20)28)16-7-4-5-9-24-16/h2-9,13,18H,10-12H2,1H3,(H,25,26,28) IOXUNEVDXLCSGD-UHFFFAOYSA-N 485665 US10940139, Example 02767::US11000515, Compound TABLE 7.318::US11213515, TABLE 7.318::US11541041, Compound Table 7.297 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485665 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485665&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429427 444855656 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006186 Oc1nc(nc2c(csc12)C(=O)N1CCOC(C1)c1ccccc1Cl)-c1ccccn1 InChI=1S/C22H17ClN4O3S/c23-15-6-2-1-5-13(15)17-11-27(9-10-30-17)22(29)14-12-31-19-18(14)25-20(26-21(19)28)16-7-3-4-8-24-16/h1-8,12,17H,9-11H2,(H,25,26,28) WXLODNXTQUPYBT-UHFFFAOYSA-N 485666 US10940139, Example 02769::US11000515, Compound TABLE 7.320::US11213515, TABLE 7.320::US11541041, Compound Table 7.299 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485666 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485666&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429422 444855657 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006187 COc1cccc(c1)C1CN(CCN1)C(=O)c1csc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C23H21N5O3S/c1-31-15-6-4-5-14(11-15)18-12-28(10-9-25-18)23(30)16-13-32-20-19(16)26-21(27-22(20)29)17-7-2-3-8-24-17/h2-8,11,13,18,25H,9-10,12H2,1H3,(H,26,27,29) AADICWYVWQNJIC-UHFFFAOYSA-N 485667 US10940139, Example 02773::US11000515, Compound TABLE 7.324::US11213515, TABLE 7.324::US11541041, Compound Table 7.303 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485667 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485667&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429440 444855658 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006188 O=C(COCc1ccc(cc1)C#N)Nc1nc(nc2sccc12)-c1ccccn1 InChI=1S/C21H15N5O2S/c22-11-14-4-6-15(7-5-14)12-28-13-18(27)24-19-16-8-10-29-21(16)26-20(25-19)17-3-1-2-9-23-17/h1-10H,12-13H2,(H,24,25,26,27) AAEQWIRZRGTVKR-UHFFFAOYSA-N 485668 US10940139, Example 02799::US11000515, Compound TABLE 7.350::US11213515, TABLE 7.350::US11541041, Compound Table 7.329 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485668 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485668&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429434 444855659 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006189 OCc1ccnc(c1)-c1nc(O)c2c(Cl)csc2n1 InChI=1S/C12H8ClN3O2S/c13-7-5-19-12-9(7)11(18)15-10(16-12)8-3-6(4-17)1-2-14-8/h1-3,5,17H,4H2,(H,15,16,18) PCIJQKQPEXUGTO-UHFFFAOYSA-N 485669 US10940139, Example 02800::US11000515, Compound TABLE 7.351::US11213515, TABLE 7.351::US11541041, Compound Table 7.330 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485669 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485669&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 145769264 444855660 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006190 Oc1ccc(cc1Cl)N1CCN(CC1)C(=O)c1csc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C22H18ClN5O3S/c23-15-11-13(4-5-17(15)29)27-7-9-28(10-8-27)22(31)14-12-32-19-18(14)25-20(26-21(19)30)16-3-1-2-6-24-16/h1-6,11-12,29H,7-10H2,(H,25,26,30) AMKZAERLFCFYKT-UHFFFAOYSA-N 485670 US10940139, Example 02803::US11000515, Compound TABLE 7.354::US11213515, TABLE 7.354::US11541041, Compound Table 7.333 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485670 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485670&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429380 444855661 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006191 CC(N1CCN(CC1)C(=O)c1csc2c(O)nc(nc12)-c1ccccn1)c1ccccc1 InChI=1S/C24H23N5O2S/c1-16(17-7-3-2-4-8-17)28-11-13-29(14-12-28)24(31)18-15-32-21-20(18)26-22(27-23(21)30)19-9-5-6-10-25-19/h2-10,15-16H,11-14H2,1H3,(H,26,27,30) ATKXAKLLWLBAGO-UHFFFAOYSA-N 485671 US10940139, Example 02804::US11000515, Compound TABLE 7.355::US11213515, TABLE 7.355::US11541041, Compound Table 7.334 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485671 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485671&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429629 444855662 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006192 Oc1ccc(cc1)C1CN(CCN1)C(=O)c1csc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C22H19N5O3S/c28-14-6-4-13(5-7-14)17-11-27(10-9-24-17)22(30)15-12-31-19-18(15)25-20(26-21(19)29)16-3-1-2-8-23-16/h1-8,12,17,24,28H,9-11H2,(H,25,26,29) QEYQMRJDTNLZIH-UHFFFAOYSA-N 485672 US10940139, Example 02808::US11000515, Compound TABLE 7.359::US11213515, TABLE 7.359::US11541041, Compound Table 7.338 GTPase KRas [G12D] Human 7500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485672 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485672&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429367 444855663 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006193 CN1CCN(CC1)c1nc(nc2scc(C(=O)NCCc3cnc(O)nc3)c12)-c1ccccn1 InChI=1S/C23H24N8O2S/c1-30-8-10-31(11-9-30)20-18-16(21(32)25-7-5-15-12-26-23(33)27-13-15)14-34-22(18)29-19(28-20)17-4-2-3-6-24-17/h2-4,6,12-14H,5,7-11H2,1H3,(H,25,32)(H,26,27,33) UBNSTQNNBOYKTA-UHFFFAOYSA-N 485673 US10940139, Example 02899::US11000515, Compound TABLE 7.450::US11213515, TABLE 7.450::US11541041, Compound Table 7.429 GTPase KRas [G12D] Human >30000 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485673 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485673&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429821 444855664 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006194 Oc1nc(nc2c(csc12)-c1cc(F)cc(F)c1)-c1ccccn1 InChI=1S/C17H9F2N3OS/c18-10-5-9(6-11(19)7-10)12-8-24-15-14(12)21-16(22-17(15)23)13-3-1-2-4-20-13/h1-8H,(H,21,22,23) KDYABNHVFVMIPD-UHFFFAOYSA-N 485674 US10940139, Example 02900::US11000515, Compound TABLE 7.451::US11213515, TABLE 7.451::US11541041, Compound Table 7.430 GTPase KRas [G12D] Human >30000 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485674 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485674&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429816 444855665 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006195 CN(C)Cc1ccc(F)c(c1)-c1csc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C20H17FN4OS/c1-25(2)10-12-6-7-15(21)13(9-12)14-11-27-18-17(14)23-19(24-20(18)26)16-5-3-4-8-22-16/h3-9,11H,10H2,1-2H3,(H,23,24,26) RXOPZZLDMNJNEE-UHFFFAOYSA-N 485675 US10940139, Example 02901::US11000515, Compound TABLE 7.452::US11213515, TABLE 7.452::US11541041, Compound Table 7.431 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485675 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485675&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429585 444855666 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006196 CCn1nc(C)cc1-c1csc2c(O)nc(nc12)-c1ccccn1 InChI=1S/C17H15N5OS/c1-3-22-13(8-10(2)21-22)11-9-24-15-14(11)19-16(20-17(15)23)12-6-4-5-7-18-12/h4-9H,3H2,1-2H3,(H,19,20,23) SCEBXYALTJICPC-UHFFFAOYSA-N 485676 US10940139, Example 02903::US11000515, Compound TABLE 7.454::US11213515, TABLE 7.454::US11541041, Compound Table 7.433 GTPase KRas [G12D] Human 20500 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485676 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485676&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429432 444855667 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10 1006197 COC(=O)c1cc2nc(nc(O)c2s1)-c1ccccn1 InChI=1S/C13H9N3O3S/c1-19-13(18)9-6-8-10(20-9)12(17)16-11(15-8)7-4-2-3-5-14-7/h2-6H,1H3,(H,15,16,17) KKXXTYBDPZNRMN-UHFFFAOYSA-N 485677 US10940139, Example 02907::US11000515, Compound TABLE 7.458::US11213515, TABLE 7.458::US11541041, Compound Table 7.437 GTPase KRas [G12D] Human >30000 US Patent 10.7270/Q2B27ZD1 aid1805321 US10940139 Hadari, YR; Carta, L; Schmertzler, M; Williams, TM; Reynolds, CH; Hutcheson, R 3/9/2021 9/20/2021 Shy Therapeutics LLC http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=485677 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1006&target=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=485677&enzyme=GTPase+KRas+%5BG12D%5D&column=ki&startPg=0&Increment=50&submit=Search 137429428 444855668 1 MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 3GFT,4EPT,4EPV,4EPW,4EPX,4EPY,4TQ9,4WA7,5KYK,5MLA,5MLB,5O2S,5O2T,5OCO,5OCT,5UFE,5UK9,5V71,5V9L,5V9O,5VP7,5VPI,5VPY,5VPZ,5VQ0,5VQ2,5VQ6,5VQ8,5W22,5WHA,5WHB,5WLB,5WPM,6ASE,6BP1,6F76,6FA1,6FA4,6GOE,6GOG,6H46,6H47,6M9W,6MNX,6MQN,6MTA,6OB3,6P0Z,6PQ3,6V6F,6WS2,6XGU,6XGV,6XHA,6XI7,6YR8,6YXW,7C40,7C41,7KFZ,7LC1,7LC2,7NY8,7RP3,7T1F,7W5R,7YCC,7YCE,8AFB,8AFC,8AZR,8AZV,8AZX,8AZZ,8EBZ,8EPW,8G4F,8STM GTPase KRas RASK_HUMAN P01116 A8K8Z5 B0LPF9 P01118 Q96D10