BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 910228 C#Cc1cncc(c1)[C@@H]1CCCCN1 InChI=1S/C12H14N2/c1-2-10-7-11(9-13-8-10)12-5-3-4-6-14-12/h1,7-9,12,14H,3-6H2/t12-/m0/s1 AKZYRLRIBHFAFC-LBPRGKRZSA-N 444828 US10667515, Compound (S)-5-ethynyl-anabasine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 140 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444828 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444828&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 134531523 440707065 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910229 Brc1cncc(c1)[C@@H]1CCCCN1 InChI=1S/C10H13BrN2/c11-9-5-8(6-12-7-9)10-3-1-2-4-13-10/h5-7,10,13H,1-4H2/t10-/m0/s1 DDOMWRSTHXDLLF-JTQLQIEISA-N 444829 US10667515, Compound (S)-5-bromo-anabasine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 320 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444829 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444829&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 7022910 440707066 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910230 CN1CCC[C@H]1c1cncc(c1)C#C InChI=1S/C12H14N2/c1-3-10-7-11(9-13-8-10)12-5-4-6-14(12)2/h1,7-9,12H,4-6H2,2H3/t12-/m0/s1 NUPUDYKEEJNZRG-LBPRGKRZSA-N 50052593 3-Ethynyl-5-((S)-1-methyl-azetidin-2-yl)-pyridine::3-Ethynyl-5-((S)-1-methyl-pyrrolidin-2-yl)-pyridine::Altinicline::CHEMBL111659::US10667515, Compound (S)-SIB 1508Y Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 370 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50052593 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50052593&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 3036156 103949434 CHEMBL111659 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910231 CN1CCCC1c1cncc(C)c1 InChI=1S/C11H16N2/c1-9-6-10(8-12-7-9)11-4-3-5-13(11)2/h6-8,11H,3-5H2,1-2H3 WPPLPODBERCBRQ-UHFFFAOYSA-N 50475399 CHEMBL364003::US10667515, Compound 5-methyl-nicotine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 990 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50475399 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50475399&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 4622927 433942664 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910232 C1CC[C@H](NC1)c1cccnc1 InChI=1S/C10H14N2/c1-2-7-12-10(5-1)9-4-3-6-11-8-9/h3-4,6,8,10,12H,1-2,5,7H2/t10-/m0/s1 MTXSIJUGVMTTMU-JTQLQIEISA-N 109767 US10667515, Compound (S)-anabasine::US8609708, 59 Anabasine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 1260 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=109767 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=109767&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 205586 186526637 28986 C06180 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910233 CN1CCC[C@H]1c1cncc(Br)c1 InChI=1S/C10H13BrN2/c1-13-4-2-3-10(13)8-5-9(11)7-12-6-8/h5-7,10H,2-4H2,1H3/t10-/m0/s1 VKHLFAFBADEABG-JTQLQIEISA-N 444833 US10667515, Compound (S)-5-bromo-nicotine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 2040 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444833 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444833&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 10633832 440707070 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910234 CN1CCC[C@H]1c1ccc(C)nc1 InChI=1S/C11H16N2/c1-9-5-6-10(8-12-9)11-4-3-7-13(11)2/h5-6,8,11H,3-4,7H2,1-2H3/t11-/m0/s1 SWNIAVIKMKSDBJ-NSHDSACASA-N 444834 US10667515, Compound 6-methyl-nicotine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 6130 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444834 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444834&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 25768196 440707071 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910235 CN1CCC[C@H]1c1cccnc1 InChI=1S/C10H14N2/c1-12-7-3-5-10(12)9-4-2-6-11-8-9/h2,4,6,8,10H,3,5,7H2,1H3/t10-/m0/s1 SNICXCGAKADSCV-JTQLQIEISA-N 82070 CAS_29790-52-1::NICOTINE-L (BASE)::Nicotine-D salicylate::US10667515, Compound (S)-nicotine::US9303017, Nicotine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 6210 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=82070 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=82070&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search NCT 89594 131342644 17688 C00745 ZINC00391812 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910236 CC(=O)OCC[N+](C)(C)C InChI=1S/C7H16NO2/c1-7(9)10-6-5-8(2,3)4/h5-6H2,1-4H3/q+1 OIPILFWXSMYKGL-UHFFFAOYSA-N 10759 2-acetoxyethyl(trimethyl)ammonium;bromide::2-acetoxyethyl(trimethyl)ammonium;perchlorate::CHEMBL667::US10667515, Compound ACh::[2-(acetyloxy)ethyl]trimethylazanium::acetylcholine::acetylcholine chloride::cid_6060 Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 6360 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=10759 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=10759&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search ACH 187 172097188 15355 CHEMBL667 DB03128 C01996 ZINC03079336 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910237 C[N+]1(C)CCC[C@H]1c1cccnc1 InChI=1S/C11H17N2/c1-13(2)8-4-6-11(13)10-5-3-7-12-9-10/h3,5,7,9,11H,4,6,8H2,1-2H3/q+1/t11-/m0/s1 WYBBYUGHCIQZBV-NSHDSACASA-N 444837 US10667515, Compound (S)-1'-methyl-nicotinium Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 10250 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444837 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444837&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 6453941 440707074 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910238 CN1CCC[C@H]1c1cncc(c1)C(C)=O InChI=1S/C12H16N2O/c1-9(15)10-6-11(8-13-7-10)12-4-3-5-14(12)2/h6-8,12H,3-5H2,1-2H3/t12-/m0/s1 XKTMQYOYEGWRBX-LBPRGKRZSA-N 444838 US10667515, Compound (S)-nicotine-5-carboxaldehyde Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 11510 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444838 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444838&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 155802662 440707075 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910239 CN1CCCC1c1ccc(N)nc1 InChI=1S/C10H15N3/c1-13-6-2-3-9(13)8-4-5-10(11)12-7-8/h4-5,7,9H,2-3,6H2,1H3,(H2,11,12) FARGKMUKCFJLSU-UHFFFAOYSA-N 50100716 5-(1-Methyl-pyrrolidin-2-yl)-pyridin-2-ylamine::CHEMBL70774::US10667515, Compound 6-AN Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 12180 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50100716 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50100716&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 3110789 103997444 CHEMBL70774 ZINC19735242 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910240 CCN1CCCC1c1cccnc1 InChI=1S/C11H16N2/c1-2-13-8-4-6-11(13)10-5-3-7-12-9-10/h3,5,7,9,11H,2,4,6,8H2,1H3 VXSLBTSUIZUVFX-UHFFFAOYSA-N 50451805 CHEMBL163042::US10667515, Compound homonicotine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 16620 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50451805 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50451805&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 4658388 225145463 CHEMBL163042 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910241 C1CNC(C1)c1cccnc1 InChI=1S/C9H12N2/c1-3-8(7-10-5-1)9-4-2-6-11-9/h1,3,5,7,9,11H,2,4,6H2 MYKUKUCHPMASKF-UHFFFAOYSA-N 50023328 3-Pyrrolidin-2-yl-pyridine::CHEMBL1132::Nornicotine::US10667515, Compound nornicotine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm 25730 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50023328 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50023328&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 412 103933832 CHEMBL1132 C06524 ZINC00391820 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910242 CN1CCCCC1c1cccnc1 InChI=1S/C11H16N2/c1-13-8-3-2-6-11(13)10-5-4-7-12-9-10/h4-5,7,9,11H,2-3,6,8H2,1H3 WHAIHNKQZOMXJJ-UHFFFAOYSA-N 50079457 1-Methyl-1,2,3,4,5,6-hexahydro-[2,3']bipyridinyl::CHEMBL102246::US10667515, Compound N-methyl-anabasine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm <100000 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50079457 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50079457&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 29758 103971709 CHEMBL102246 ZINC00517558 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910243 CN1CCC[C@H]1c1ccc[n+](C)c1 InChI=1S/C11H17N2/c1-12-7-3-5-10(9-12)11-6-4-8-13(11)2/h3,5,7,9,11H,4,6,8H2,1-2H3/q+1/t11-/m0/s1 HIOROZIUERMMRQ-NSHDSACASA-N 444843 US10667515, Compound (S)-1-methyl-nicotinium Resistance to inhibitors of cholinesterase protein 3 Pig roundworm <100000 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=444843 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=444843&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search 88903 440707080 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9 910244 CN1[C@@H](CCC1=O)c1cccnc1 InChI=1S/C10H12N2O/c1-12-9(4-5-10(12)13)8-3-2-6-11-7-8/h2-3,6-7,9H,4-5H2,1H3/t9-/m0/s1 UIKROCXWUNQSPJ-VIFPVBQESA-N 50370573 COTININE::US10667515, Compound (S)-cotinine::US8609708, 91 Cotinine Resistance to inhibitors of cholinesterase protein 3 Pig roundworm <100000 US Patent 10.7270/Q23N26DQ aid1804435 US10667515 Martin, RJ; Robertson, AP; VanVeller, B; Du, X; Zheng, F 6/2/2020 2/15/2021 Iowa State University Research Foundation, Inc. http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50370573 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=869&target=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50370573&enzyme=Resistance+to+inhibitors+of+cholinesterase+protein+3&column=ki&startPg=0&Increment=50&submit=Search U5H 854019 160849675 68641 ZINC00402766 1 MPNSETATRSRRRRRRSSDDDDGPVSGWKMGLVVGVVVLCFGMLYPSLFHPMISSFFSKPPPPQQTIPNRPPIHPSMSSPRARPDIHPGMRMAAAQAEATATSSSKGMFAWMLPLYTVGVVVFLIYTLVKSKRKKQRRRHAYSSDESESYGEDDEYEQRGPGVHNLGRRKLRSLQERLKQTELAMSKILEQLGTISVDPTQGTVPQNLENTVDQKSKTNGESKKADVDKEHYLRDLEKALREFKHLSNSYNKEERKRRGESLSEEEEMNEDEFEEEMDEDEGTEEKSHGGGGSAGSAAEDEAENCSEDEREEKQEDDGKKGEDEVLVPAVEQHVQQTKPHKRSKRT Resistance to inhibitors of cholinesterase protein 3 F1L1D9_ASCSU F1L1D9