BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 884048 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1nccs1 435072 US10584120, Compound 1 Glutaminyl-peptide cyclotransferase Homo sapiens 53.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435072 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435072&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422827 438643864 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884049 Cc1csc(n1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435073 US10584120, Compound 2 Glutaminyl-peptide cyclotransferase Homo sapiens 100.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435073 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435073&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422815 438643865 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884050 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1nc(cs1)C1CC1 435074 US10584120, Compound 3 Glutaminyl-peptide cyclotransferase Homo sapiens 348 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435074 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435074&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422719 438643866 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884051 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1cnc(s1)C1CC1 435075 US10584120, Compound 7 Glutaminyl-peptide cyclotransferase Homo sapiens 21.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435075 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435075&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422826 438643867 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884052 FC(F)(F)c1ncc(s1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435076 US10584120, Compound 8 Glutaminyl-peptide cyclotransferase Homo sapiens 49.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435076 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435076&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422658 438643868 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884053 FC(F)(F)c1ncc(s1)-c1ccc(cc1)[C@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435078 US10584120, Compound 9 Glutaminyl-peptide cyclotransferase Homo sapiens 16.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435078 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435078&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422635 438643870 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884054 FC(F)(F)c1ncc(s1)-c1ccc(cc1)[C@@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435079 US10584120, Compound 10 Glutaminyl-peptide cyclotransferase Homo sapiens 964 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435079 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435079&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422735 438643871 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884055 Cc1ccc(s1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435080 US10584120, Compound 11 Glutaminyl-peptide cyclotransferase Homo sapiens 100.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435080 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435080&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422736 438643872 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884056 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1ccc(s1)C1CC1 435081 US10584120, Compound 12 Glutaminyl-peptide cyclotransferase Homo sapiens 132 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435081 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435081&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422807 438643873 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884057 FC(F)(F)c1ccc(s1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435082 US10584120, Compound 13 Glutaminyl-peptide cyclotransferase Homo sapiens 124 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435082 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435082&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422777 438643874 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884058 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1ccsc1 435083 US10584120, Compound 14 Glutaminyl-peptide cyclotransferase Homo sapiens 106 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435083 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435083&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422643 438643875 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884059 Cc1cc(cs1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435084 US10584120, Compound 15 Glutaminyl-peptide cyclotransferase Homo sapiens 76.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435084 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435084&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422629 438643876 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884060 FC(F)(F)c1cc(cs1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435085 US10584120, Compound 16 Glutaminyl-peptide cyclotransferase Homo sapiens 112 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435085 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435085&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422752 438643877 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884061 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1csc(c1)C1CC1 435086 US10584120, Compound 17 Glutaminyl-peptide cyclotransferase Homo sapiens 151 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435086 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435086&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422648 438643878 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884062 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1noc(n1)C1CC1 435087 US10584120, Compound 18 Glutaminyl-peptide cyclotransferase Homo sapiens 134 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435087 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435087&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422755 438643879 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884063 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1cc(no1)C1CC1 435088 US10584120, Compound 19 Glutaminyl-peptide cyclotransferase Homo sapiens 58.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435088 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435088&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146438947 438643880 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884064 CCCn1nnc(n1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435089 US10584120, Compound 20 Glutaminyl-peptide cyclotransferase Homo sapiens 57.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435089 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435089&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422726 438643881 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884065 CC(C)n1nnc(n1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435090 US10584120, Compound 21 Glutaminyl-peptide cyclotransferase Homo sapiens 36.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435090 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435090&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422631 438643882 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884066 Fc1cc(ccc1-c1ccc(s1)C(F)(F)F)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435091 US10584120, Compound 22 Glutaminyl-peptide cyclotransferase Homo sapiens 156 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435091 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435091&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422754 438643883 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884067 Fc1cc(ccc1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1ccc(s1)C(F)(F)F 435092 US10584120, Compound 23 Glutaminyl-peptide cyclotransferase Homo sapiens 124 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435092 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435092&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422846 438643884 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884068 Fc1cc(cc(F)c1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1ccc(s1)C(F)(F)F 435093 US10584120, Compound 24 Glutaminyl-peptide cyclotransferase Homo sapiens 101 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435093 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435093&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422696 438643885 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884069 Fc1cc(ccc1-c1csc(c1)C(F)(F)F)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435094 US10584120, Compound 25 Glutaminyl-peptide cyclotransferase Homo sapiens 71.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435094 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435094&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422637 438643886 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884070 Fc1cc(ccc1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1csc(c1)C(F)(F)F 435095 US10584120, Compound 26 Glutaminyl-peptide cyclotransferase Homo sapiens 114 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435095 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435095&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422660 438643887 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884071 Fc1cc(cc(F)c1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1csc(c1)C(F)(F)F 435096 US10584120, Compound 27 Glutaminyl-peptide cyclotransferase Homo sapiens 66.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435096 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435096&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422711 438643888 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884072 Fc1c(F)c(ccc1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1csc(c1)C(F)(F)F 435097 US10584120, Compound 28 Glutaminyl-peptide cyclotransferase Homo sapiens 39.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435097 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435097&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422661 438643889 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884073 Clc1ccc(s1)-c1ccc(cc1)C1CNC(=O)N1c1ccc2[nH]cnc2c1 435098 US10584120, Compound 29 Glutaminyl-peptide cyclotransferase Homo sapiens 72.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435098 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435098&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422646 438643890 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884074 FC(F)(F)c1ccc(s1)-c1ccc(cc1)[C@@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435099 US10584120, Compound 33 Glutaminyl-peptide cyclotransferase Homo sapiens 736 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435099 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435099&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422632 438643891 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884075 FC(F)(F)c1ccc(s1)-c1ccc(cc1)[C@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435100 US10584120, Compound 34 Glutaminyl-peptide cyclotransferase Homo sapiens 69.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435100 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435100&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422733 438643892 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884076 FC(F)(F)c1cc(cs1)-c1ccc(cc1)[C@@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435101 US10584120, Compound 35 Glutaminyl-peptide cyclotransferase Homo sapiens 2053 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435101 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435101&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422772 438643893 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884077 FC(F)(F)c1cc(cs1)-c1ccc(cc1)[C@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435102 US10584120, Compound 36 Glutaminyl-peptide cyclotransferase Homo sapiens 32.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435102 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435102&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422796 438643894 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884078 FC(F)(F)c1csc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435103 US10584120, Compound 37 Glutaminyl-peptide cyclotransferase Homo sapiens 18.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435103 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435103&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422834 438643895 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884079 O=C1NC(=O)N(C1c1ccc(cc1)-c1csc(n1)C1CC1)c1ccc2[nH]cnc2c1 435104 US10584120, Compound 38 Glutaminyl-peptide cyclotransferase Homo sapiens 4.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435104 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435104&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422749 438643896 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884080 O=C1NC(=O)N(C1c1ccc(cc1)-c1cnc(s1)C1CC1)c1ccc2[nH]cnc2c1 435105 US10584120, Compound 39 Glutaminyl-peptide cyclotransferase Homo sapiens 4.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435105 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435105&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422738 438643897 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884081 FC(F)(F)c1ncc(s1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435106 US10584120, Compound 40 Glutaminyl-peptide cyclotransferase Homo sapiens 9.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435106 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435106&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422713 438643898 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884082 Cn1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435107 US10584120, Compound 41 Glutaminyl-peptide cyclotransferase Homo sapiens 12.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435107 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435107&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422638 438643899 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884083 CCCn1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435108 US10584120, Compound 42 Glutaminyl-peptide cyclotransferase Homo sapiens 5.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435108 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435108&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422776 438643900 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884084 CC(C)n1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435109 US10584120, Compound 43 Glutaminyl-peptide cyclotransferase Homo sapiens 8.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435109 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435109&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422657 438643901 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884085 CC(C)Cn1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435110 US10584120, Compound 44 Glutaminyl-peptide cyclotransferase Homo sapiens 10.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435110 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435110&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422642 438643902 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884086 O=C1NC(=O)N(C1c1ccc(cc1)-c1nnn(CC2CC2)n1)c1ccc2[nH]cnc2c1 435111 US10584120, Compound 45 Glutaminyl-peptide cyclotransferase Homo sapiens 4.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435111 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435111&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422769 438643903 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884087 FC(F)(F)Cn1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435112 US10584120, Compound 46 Glutaminyl-peptide cyclotransferase Homo sapiens 8.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435112 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435112&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422788 438643904 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884088 O=C1NC(=O)N(C1c1ccc(cc1)-c1nnn(CC#C)n1)c1ccc2[nH]cnc2c1 435114 US10584120, Compound 47 Glutaminyl-peptide cyclotransferase Homo sapiens 6.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435114 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435114&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422645 438643906 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884089 CC#CCn1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435115 US10584120, Compound 48 Glutaminyl-peptide cyclotransferase Homo sapiens 10.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435115 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435115&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422690 438643907 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884090 CCC#CCn1nnc(n1)-c1ccc(cc1)C1N(C(=O)NC1=O)c1ccc2[nH]cnc2c1 435116 US10584120, Compound 49 Glutaminyl-peptide cyclotransferase Homo sapiens 10.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435116 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435116&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422758 438643908 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884091 Clc1ccc(Cn2nnc(n2)-c2ccc(cc2)C2N(C(=O)NC2=O)c2ccc3[nH]cnc3c2)cc1 435117 US10584120, Compound 50 Glutaminyl-peptide cyclotransferase Homo sapiens 13.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435117 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435117&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422715 438643909 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884092 COc1ccc(Cn2nnc(n2)-c2ccc(cc2)C2N(C(=O)NC2=O)c2ccc3[nH]cnc3c2)cc1 435118 US10584120, Compound 51 Glutaminyl-peptide cyclotransferase Homo sapiens 24.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435118 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435118&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422694 438643910 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884093 Cc1cc(Cn2nnc(n2)-c2ccc(cc2)C2N(C(=O)NC2=O)c2ccc3[nH]cnc3c2)on1 435119 US10584120, Compound 52 Glutaminyl-peptide cyclotransferase Homo sapiens 397 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435119 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435119&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422706 438643911 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884094 Fc1cc(ccc1-c1csc(c1)C(F)(F)F)[C@@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435120 US10584120, Compound 53 Glutaminyl-peptide cyclotransferase Homo sapiens 3417 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435120 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435120&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146439016 438643912 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884095 Fc1cc(ccc1-c1csc(c1)C(F)(F)F)[C@H]1CNC(=O)N1c1ccc2[nH]cnc2c1 435121 US10584120, Compound 54 Glutaminyl-peptide cyclotransferase Homo sapiens 23.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435121 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435121&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146438955 438643913 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884096 Fc1c(F)c(ccc1[C@@H]1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1csc(c1)C(F)(F)F 435122 US10584120, Compound 55 Glutaminyl-peptide cyclotransferase Homo sapiens 1592 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435122 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435122&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146439017 438643914 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884097 Fc1c(F)c(ccc1[C@H]1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1csc(c1)C(F)(F)F 435123 US10584120, Compound 56 Glutaminyl-peptide cyclotransferase Homo sapiens 7.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435123 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435123&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146439015 438643915 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884098 O=C1NCC(N1c1ccc2[nH]cnc2c1)c1ccc(cc1)-c1cnc(s1)C12CC3CC(CC(C3)C1)C2 435124 US10584120, Compound 57 Glutaminyl-peptide cyclotransferase Homo sapiens 87.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435124 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435124&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146432654 438643916 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884099 Fc1c(F)c(ccc1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1csc(Cl)c1 435125 US10584120, Compound 59 Glutaminyl-peptide cyclotransferase Homo sapiens 19.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435125 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435125&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422756 438643917 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884100 Cc1cc(cs1)-c1ccc(C2CNC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 435126 US10584120, Compound 60 Glutaminyl-peptide cyclotransferase Homo sapiens 7.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435126 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435126&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422655 438643918 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884101 CCc1cc(cs1)-c1ccc(C2CNC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 435127 US10584120, Compound 61 Glutaminyl-peptide cyclotransferase Homo sapiens 16.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435127 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435127&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422668 438643919 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884102 COCc1cc(cs1)-c1ccc(C2CNC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 435128 US10584120, Compound 62 Glutaminyl-peptide cyclotransferase Homo sapiens 6.00 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435128 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435128&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422822 438643920 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884103 CCOCc1cc(cs1)-c1ccc(C2CNC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 435129 US10584120, Compound 63 Glutaminyl-peptide cyclotransferase Homo sapiens 11.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435129 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435129&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422823 438643921 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884104 COC(=O)c1cc(cs1)-c1ccc(C2CNC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 435130 US10584120, Compound 64 Glutaminyl-peptide cyclotransferase Homo sapiens 13.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435130 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435130&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422656 438643922 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 884105 Fc1c(F)c(ccc1C1CNC(=O)N1c1ccc2[nH]cnc2c1)-c1ccsc1 435131 US10584120, Compound 65 Glutaminyl-peptide cyclotransferase Homo sapiens 20.0 US Patent 10.7270/Q2ZK5K20 aid1804256 US10584120 Chen, C; Shih, C; Chen, C; Wang, H; Huang, K 3/10/2020 11/29/2020 National Health Research Institutes; Academia Sinica http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=435131 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=435131&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 146422700 438643923 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4