BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
826036	COc1ccc(CN2CC(OC3(CC3)C2=O)C2CCN(CCc3ccccc3)CC2)cc1	InChI=1S/C27H34N2O3/c1-31-24-9-7-22(8-10-24)19-29-20-25(32-27(14-15-27)26(29)30)23-12-17-28(18-13-23)16-11-21-5-3-2-4-6-21/h2-10,23,25H,11-20H2,1H3	FPCKZPKRVJYHSK-UHFFFAOYSA-N	413869	7-(4-methoxybenzyl)-5-(1- phenethylpiperidin-4-yl)-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 1	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413869	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413869&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053781	433913968							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826037	O=C(N1CC(OC2(CC2)C1)C1CCN(CCc2ccccc2)CC1)c1ccccc1	InChI=1S/C26H32N2O2/c29-25(23-9-5-2-6-10-23)28-19-24(30-26(20-28)14-15-26)22-12-17-27(18-13-22)16-11-21-7-3-1-4-8-21/h1-10,22,24H,11-20H2	JHJWPVGJYYEGQW-UHFFFAOYSA-N	413870	(5-(1-phenethylpiperidin-4-yl)-4-oxa-7- azaspiro[2.5]octan-7- yl)(phenyl)methanone::US10421750, Example 2	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413870	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413870&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073785	433913969							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826038	COc1ccc(CN2CC(OC3(CC3)C2=O)C2CCN(Cc3ccccc3)CC2)cc1	InChI=1S/C26H32N2O3/c1-30-23-9-7-21(8-10-23)18-28-19-24(31-26(13-14-26)25(28)29)22-11-15-27(16-12-22)17-20-5-3-2-4-6-20/h2-10,22,24H,11-19H2,1H3	JWDSBOKEBGRCRE-UHFFFAOYSA-N	413871	5-(1-benzylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 3	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413871	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413871&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053750	433913970							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826039	O=C(N1CC(OC2(CC2)C1)C1CCN(Cc2ccccc2)CC1)c1ccccc1	InChI=1S/C25H30N2O2/c28-24(22-9-5-2-6-10-22)27-18-23(29-25(19-27)13-14-25)21-11-15-26(16-12-21)17-20-7-3-1-4-8-20/h1-10,21,23H,11-19H2	BIAASZQCJXPHGY-UHFFFAOYSA-N	413872	(5-(1-benzylpiperidin-4-yl)-4-oxa-7- azaspiro[2.5]octan-7- yl)(phenyl)methanone::US10421750, Example 4	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413872	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413872&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053725	433913971							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826040	CCN1CC(OC2(CC2)C1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C20H28N2O2/c1-2-22-15-18(24-20(10-11-20)19(22)23)17-8-12-21(13-9-17)14-16-6-4-3-5-7-16/h3-7,17-18H,2,8-15H2,1H3	XFVQONQJKQLXDH-UHFFFAOYSA-N	413873	5-(1-benzylpiperidin-4-yl)-7-ethyl-4- oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 5	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413873	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413873&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053739	433913972							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826041	CCN1CCC(CC1)C1CN(Cc2ccc(OC)cc2)C(=O)C2(CC2)O1	InChI=1S/C21H30N2O3/c1-3-22-12-8-17(9-13-22)19-15-23(20(24)21(26-19)10-11-21)14-16-4-6-18(25-2)7-5-16/h4-7,17,19H,3,8-15H2,1-2H3	QKXZGAVAQKHMNT-UHFFFAOYSA-N	413874	5-(1-ethylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 6	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413874	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413874&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073965	433913973							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826042	CCN1CC(OC2(CC2)C1=O)C1CCN(CCc2ccccc2)CC1	InChI=1S/C21H30N2O2/c1-2-23-16-19(25-21(11-12-21)20(23)24)18-9-14-22(15-10-18)13-8-17-6-4-3-5-7-17/h3-7,18-19H,2,8-16H2,1H3	AKBWJPVSDFJNJS-UHFFFAOYSA-N	413875	7-ethyl-5-(1-phenethylpiperidin-4-yl)- 4-oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 7	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413875	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413875&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053734	433913974							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826043	CC(C)N1CC(OC2(CC2)C1=O)C1CCN(CCc2ccccc2)CC1	InChI=1S/C22H32N2O2/c1-17(2)24-16-20(26-22(11-12-22)21(24)25)19-9-14-23(15-10-19)13-8-18-6-4-3-5-7-18/h3-7,17,19-20H,8-16H2,1-2H3	KBLGGNKBCZLECW-UHFFFAOYSA-N	413876	7-isopropyl-5-(1-phenethylpiperidin-4- yl)-4-oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 8	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413876	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413876&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073951	433913975							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826044	O=C1N(CC(OC11CC1)C1CCN(CCc2ccccc2)CC1)c1ccccc1	InChI=1S/C25H30N2O2/c28-24-25(14-15-25)29-23(19-27(24)22-9-5-2-6-10-22)21-12-17-26(18-13-21)16-11-20-7-3-1-4-8-20/h1-10,21,23H,11-19H2	DAZUMGAVOZBHQL-UHFFFAOYSA-N	413877	5-(1-phenethylpiperidin-4-yl)-7- phenyl-4-oxa-7-azaspiro[2.5]octan-8- one::US10421750, Example 9	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413877	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413877&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053768	433913976							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826045	O=C1N(CC(OC11CC1)C1CCN(Cc2ccccc2)CC1)c1ccccc1	InChI=1S/C24H28N2O2/c27-23-24(13-14-24)28-22(18-26(23)21-9-5-2-6-10-21)20-11-15-25(16-12-20)17-19-7-3-1-4-8-19/h1-10,20,22H,11-18H2	ZTQMBKOMYWAVCQ-UHFFFAOYSA-N	413878	5-(1-benzylpiperidin-4-yl)-7-phenyl-4- oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 10	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413878	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413878&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053793	433913977							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826046	CCN1CC(OC2(CC2)C1)C1CCN(CCc2ccccc2)CC1	InChI=1S/C21H32N2O/c1-2-22-16-20(24-21(17-22)11-12-21)19-9-14-23(15-10-19)13-8-18-6-4-3-5-7-18/h3-7,19-20H,2,8-17H2,1H3	LFSWDRSMOARPDK-UHFFFAOYSA-N	413879	7-ethyl-5-(1-phenethylpiperidin-4-yl)- 4-oxa-7-azaspiro[2.5]octane::US10421750, Example 11	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413879	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413879&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053751	433913978							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826047	COc1ccc(CN2CC(OC3(CC3)C2)C2CCN(Cc3ccccc3)CC2)cc1	InChI=1S/C26H34N2O2/c1-29-24-9-7-22(8-10-24)18-28-19-25(30-26(20-28)13-14-26)23-11-15-27(16-12-23)17-21-5-3-2-4-6-21/h2-10,23,25H,11-20H2,1H3	POTDIHZAEXPPIR-UHFFFAOYSA-N	413880	5-(1-benzylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octane::US10421750, Example 12	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413880	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413880&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073948	433913979							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826048	COc1ccc(CN2CC(OC3(CC3)C2)C2CCN(CCc3ccccc3)CC2)cc1	InChI=1S/C27H36N2O2/c1-30-25-9-7-23(8-10-25)19-29-20-26(31-27(21-29)14-15-27)24-12-17-28(18-13-24)16-11-22-5-3-2-4-6-22/h2-10,24,26H,11-21H2,1H3	JPSWJFNUCTTWIL-UHFFFAOYSA-N	413881	7-(4-methoxybenzyl)-5-(1- phenethylpiperidin-4-yl)-4-oxa-7- azaspiro[2.5]octane::US10421750, Example 13	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413881	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413881&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073947	433913980							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826049	CCN1CC(OC2(CC2)C1)C1CCN(Cc2ccccc2)CC1	InChI=1S/C20H30N2O/c1-2-21-15-19(23-20(16-21)10-11-20)18-8-12-22(13-9-18)14-17-6-4-3-5-7-17/h3-7,18-19H,2,8-16H2,1H3	JYDIMCXCONPBLV-UHFFFAOYSA-N	413882	5-(1-benzylpiperidin-4-yl)-7-ethyl-4- oxa-7-azaspiro[2.5]octane::US10421750, Example 14	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413882	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413882&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053742	433913981							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826050	COc1ccc(CN2CC(OC3(CC3)C2=O)C2CCN(CC(C)C)CC2)cc1	InChI=1S/C23H34N2O3/c1-17(2)14-24-12-8-19(9-13-24)21-16-25(22(26)23(28-21)10-11-23)15-18-4-6-20(27-3)7-5-18/h4-7,17,19,21H,8-16H2,1-3H3	MDQJOSZDVVOWDG-UHFFFAOYSA-N	413883	5-(1-isobutylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 15	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413883	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413883&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073789	433913982							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826051	COc1ccc(CN2CC(OC3(CC3)C2=O)C2CCN(CCC(C)C)CC2)cc1	InChI=1S/C24H36N2O3/c1-18(2)8-13-25-14-9-20(10-15-25)22-17-26(23(27)24(29-22)11-12-24)16-19-4-6-21(28-3)7-5-19/h4-7,18,20,22H,8-17H2,1-3H3	WSOMSVCEESORGY-UHFFFAOYSA-N	413884	5-(1-isopentylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 16	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413884	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413884&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073770	433913983							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826052	COc1ccc(CN2CC(OCC2=O)C2CCN(Cc3ccccc3)CC2)cc1	InChI=1S/C24H30N2O3/c1-28-22-9-7-20(8-10-22)16-26-17-23(29-18-24(26)27)21-11-13-25(14-12-21)15-19-5-3-2-4-6-19/h2-10,21,23H,11-18H2,1H3	JCFSNYGHUBMUDJ-UHFFFAOYSA-N	413885	6-(1-benzylpiperidin-4-yl)-4-(4- methoxybenzyl)morpholin-3-one::US10421750, Example 21	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413885	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413885&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073775	433913984							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826053	CCN1CC(OC2(CC2)C1=O)C1CN(CCC(C)C)C1	InChI=1S/C16H28N2O2/c1-4-18-11-14(20-16(6-7-16)15(18)19)13-9-17(10-13)8-5-12(2)3/h12-14H,4-11H2,1-3H3	ZYIMPKWZDCHQBW-UHFFFAOYSA-N	413886	7-ethyl-5-(1-isopentylazetidin-3-yl)- 4-oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 22	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413886	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413886&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053760	433913985							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826054	CCN1C[C@H](O[C@@H](C)C1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C19H28N2O2/c1-3-21-14-18(23-15(2)19(21)22)17-9-11-20(12-10-17)13-16-7-5-4-6-8-16/h4-8,15,17-18H,3,9-14H2,1-2H3/t15-,18-/m0/s1	HEYGKKBYNYAZMN-YJBOKZPZSA-N	413887	(2S,6R)-6-(1-benzylpiperidin-4-yl)- 4-ethyl-2-methylmorpholin-3-one::US10421750, Example 23	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413887	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413887&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053763	433913986							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826055	CCN1C[C@@H](O[C@@H](C)C1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C19H28N2O2/c1-3-21-14-18(23-15(2)19(21)22)17-9-11-20(12-10-17)13-16-7-5-4-6-8-16/h4-8,15,17-18H,3,9-14H2,1-2H3/t15-,18+/m0/s1	HEYGKKBYNYAZMN-MAUKXSAKSA-N	413888	(2S,6S)-6-(1-benzylpiperidin-4-yl)- 4-ethyl-2-methylmorpholin-3-one::US10421750, Example 24	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413888	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413888&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053789	433913987							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826056	CCN1C[C@H](O[C@H](C)C1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C19H28N2O2/c1-3-21-14-18(23-15(2)19(21)22)17-9-11-20(12-10-17)13-16-7-5-4-6-8-16/h4-8,15,17-18H,3,9-14H2,1-2H3/t15-,18+/m1/s1	HEYGKKBYNYAZMN-QAPCUYQASA-N	413889	(2R,6R)-6-(1-benzylpiperidin-4-yl)- 4-ethyl-2-methylmorpholin-3-one::US10421750, Example 25	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413889	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413889&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053788	433913988							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826057	CCN1C[C@@H](O[C@H](C)C1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C19H28N2O2/c1-3-21-14-18(23-15(2)19(21)22)17-9-11-20(12-10-17)13-16-7-5-4-6-8-16/h4-8,15,17-18H,3,9-14H2,1-2H3/t15-,18-/m1/s1	HEYGKKBYNYAZMN-CRAIPNDOSA-N	413890	(2R,6S)-6-(1-benzylpiperidin-4-yl)- 4-ethyl-2-methylmorpholin-3-one::US10421750, Example 26	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413890	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413890&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053761	433913989							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826058	CCN1C[C@H](O[C@@H](C)C1=O)C1CCN(Cc2ccc(F)cc2)CC1	InChI=1S/C19H27FN2O2/c1-3-22-13-18(24-14(2)19(22)23)16-8-10-21(11-9-16)12-15-4-6-17(20)7-5-15/h4-7,14,16,18H,3,8-13H2,1-2H3/t14-,18-/m0/s1	VXVDIHXKTGEARI-KSSFIOAISA-N	413891	(2S,6R)-4-ethyl-6-(1-(4- fluorobenzyl)piperidin-4-yl)-2- methylmorpholin-3-one::US10421750, Example 27	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413891	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413891&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053741	433913990							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826059	CCN1C[C@@H](O[C@@H](C)C1=O)C1CCN(Cc2ccc(F)cc2)CC1	InChI=1S/C19H27FN2O2/c1-3-22-13-18(24-14(2)19(22)23)16-8-10-21(11-9-16)12-15-4-6-17(20)7-5-15/h4-7,14,16,18H,3,8-13H2,1-2H3/t14-,18+/m0/s1	VXVDIHXKTGEARI-KBXCAEBGSA-N	413892	(2S,6S)-4-ethyl-6-(1-(4- fluorobenzyl)piperidin-4-yl)-2- methylmorpholin-3-one::US10421750, Example 28	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413892	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413892&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053831	433913991							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826060	CCN1C[C@H](O[C@H](C)C1=O)C1CCN(Cc2ccc(F)cc2)CC1	InChI=1S/C19H27FN2O2/c1-3-22-13-18(24-14(2)19(22)23)16-8-10-21(11-9-16)12-15-4-6-17(20)7-5-15/h4-7,14,16,18H,3,8-13H2,1-2H3/t14-,18+/m1/s1	VXVDIHXKTGEARI-KDOFPFPSSA-N	413893	(2R,6R)-4-ethyl-6-(1-(4- fluorobenzyl)piperidin-4-yl)-2- methylmorpholin-3-one::US10421750, Example 29	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413893	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413893&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053743	433913992							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826061	CCN1C[C@@H](O[C@H](C)C1=O)C1CCN(Cc2ccc(F)cc2)CC1	InChI=1S/C19H27FN2O2/c1-3-22-13-18(24-14(2)19(22)23)16-8-10-21(11-9-16)12-15-4-6-17(20)7-5-15/h4-7,14,16,18H,3,8-13H2,1-2H3/t14-,18-/m1/s1	VXVDIHXKTGEARI-RDTXWAMCSA-N	413894	(2R,6S)-4-ethyl-6-(1-(4- fluorobenzyl)piperidin-4-yl)-2- methylmorpholin-3-one::US10421750, Example 30	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413894	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413894&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053771	433913993							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826062	CCN1C[C@H](O[C@@H](C)C1=O)C1CCN(Cc2ccc(cc2)C#N)CC1	InChI=1S/C20H27N3O2/c1-3-23-14-19(25-15(2)20(23)24)18-8-10-22(11-9-18)13-17-6-4-16(12-21)5-7-17/h4-7,15,18-19H,3,8-11,13-14H2,1-2H3/t15-,19-/m0/s1	FCWDXQYNNBSWHW-KXBFYZLASA-N	413895	4-((4-((2R,6S)-4-ethyl-6-methyl-5- oxomorpholin-2-yl)piperidin-1- yl)methyl)benzonittile-::US10421750, Example 31	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413895	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413895&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053749	433913994							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826063	CCN1C[C@@H](O[C@@H](C)C1=O)C1CCN(Cc2ccc(cc2)C#N)CC1	InChI=1S/C20H27N3O2/c1-3-23-14-19(25-15(2)20(23)24)18-8-10-22(11-9-18)13-17-6-4-16(12-21)5-7-17/h4-7,15,18-19H,3,8-11,13-14H2,1-2H3/t15-,19+/m0/s1	FCWDXQYNNBSWHW-HNAYVOBHSA-N	413896	4-((4-((2S,6S)-4-ethyl-6-methyl-5- oxomorpholin-2-yl)piperidin-1- yl)methyl)benzonitnle::US10421750, Example 32	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413896	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413896&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053785	433913995							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826064	CCN1C[C@H](O[C@H](C)C1=O)C1CCN(Cc2ccc(cc2)C#N)CC1	InChI=1S/C20H27N3O2/c1-3-23-14-19(25-15(2)20(23)24)18-8-10-22(11-9-18)13-17-6-4-16(12-21)5-7-17/h4-7,15,18-19H,3,8-11,13-14H2,1-2H3/t15-,19+/m1/s1	FCWDXQYNNBSWHW-BEFAXECRSA-N	413897	4-((4-((2R,6R)-4-ethyl-6-methyl-5- oxomorpholin-2-yl)piperidin-1- yl)methyl)benzonitrile::US10421750, Example 33	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413897	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413897&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053758	433913996							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826065	CCN1C[C@@H](O[C@H](C)C1=O)C1CCN(Cc2ccc(cc2)C#N)CC1	InChI=1S/C20H27N3O2/c1-3-23-14-19(25-15(2)20(23)24)18-8-10-22(11-9-18)13-17-6-4-16(12-21)5-7-17/h4-7,15,18-19H,3,8-11,13-14H2,1-2H3/t15-,19-/m1/s1	FCWDXQYNNBSWHW-DNVCBOLYSA-N	413898	4-((4-((2S,6R)-4-ethyl-6-methyl-5- oxomorpholin-2-yl)piperidin-1- yl)methyl)benzonitrile::US10421750, Example 34	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413898	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413898&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073955	433913997							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826066	CCN1CC(OC2(CC2)C1=O)C1CCN(Cc2ccc(F)cc2)CC1	InChI=1S/C20H27FN2O2/c1-2-23-14-18(25-20(9-10-20)19(23)24)16-7-11-22(12-8-16)13-15-3-5-17(21)6-4-15/h3-6,16,18H,2,7-14H2,1H3	UPHSHSDRSCBYPX-UHFFFAOYSA-N	413899	7-ethyl-5-(1-(4- fluorobenzyl)piperidin-4-yl)4-oxa- 7-azaspiro[2.5]octan-8-one::US10421750, Example 35	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413899	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413899&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073954	433913998							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826067	CCN1CC(OC2(CC2)C1=O)C1CCN(Cc2ccc(cc2)C#N)CC1	InChI=1S/C21H27N3O2/c1-2-24-15-19(26-21(9-10-21)20(24)25)18-7-11-23(12-8-18)14-17-5-3-16(13-22)4-6-17/h3-6,18-19H,2,7-12,14-15H2,1H3	NSTOCYDGGSNUTK-UHFFFAOYSA-N	413900	4-((4-(7-ethyl-8-oxo-4-oxa-7- azaspiro[2.5]octan-5-yl)piperidin-1- yl)methyl)benzonitrile::US10421750, Example 36	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413900	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413900&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073932	433913999							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826068	CC(C)N1CC(OC2(CC2)C1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C21H30N2O2/c1-16(2)23-15-19(25-21(10-11-21)20(23)24)18-8-12-22(13-9-18)14-17-6-4-3-5-7-17/h3-7,16,18-19H,8-15H2,1-2H3	KKOHVFMPDWJMLP-UHFFFAOYSA-N	413901	5-(1-benzylpiperidin-4-yl)-7- isopropyl-4-oxa-7- azaspiro[2.5]octan-3-one::US10421750, Example 37	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413901	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413901&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073933	433914000							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826069	CC(C)N1CC(OC2(CC2)C1=O)C1CCN(Cc2ccc(F)cc2)CC1	InChI=1S/C21H29FN2O2/c1-15(2)24-14-19(26-21(9-10-21)20(24)25)17-7-11-23(12-8-17)13-16-3-5-18(22)6-4-16/h3-6,15,17,19H,7-14H2,1-2H3	GZBQYWKTOOULBS-UHFFFAOYSA-N	413902	5-(1-(4-fluorobenzyl)piperidin-4-yl)- 7-isopropyl-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 38	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413902	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413902&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073936	433914001							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826070	CC(C)N1CC(OC2(CC2)C1=O)C1CCN(Cc2ccc(cc2)C#N)CC1	InChI=1S/C22H29N3O2/c1-16(2)25-15-20(27-22(9-10-22)21(25)26)19-7-11-24(12-8-19)14-18-5-3-17(13-23)4-6-18/h3-6,16,19-20H,7-12,14-15H2,1-2H3	DYNQJNPGMVZCCY-UHFFFAOYSA-N	413903	4-((4-(7-isopropyl-8-oxo-4-oxa,7- azaspiro[2.5]octan-5-yl)piperidin-1- yl)methyl)benzonitrile::US10421750, Example 39	Sigma non-opioid intracellular receptor 1	Homo sapiens	>500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413903	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413903&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073935	433914002							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826071	CCN1CC(OC2(CC2)C1=O)C1CCN(CCC(C)C)CC1	InChI=1S/C18H32N2O2/c1-4-20-13-16(22-18(8-9-18)17(20)21)15-6-11-19(12-7-15)10-5-14(2)3/h14-16H,4-13H2,1-3H3	GFJZNWPQOGFYAD-UHFFFAOYSA-N	413904	7-ethyl-5-(1-isopentylpiperidin-4- yl)-4-oxa-7-azaspiro[2.5]octan-8- one::US10421750, Example 40	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413904	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413904&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073796	433914003							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826072	CCN1CC(OCC1=O)C1CCN(Cc2ccccc2)CC1	InChI=1S/C18H26N2O2/c1-2-20-13-17(22-14-18(20)21)16-8-10-19(11-9-16)12-15-6-4-3-5-7-15/h3-7,16-17H,2,8-14H2,1H3	SFINQBUJIMKKQY-UHFFFAOYSA-N	413905	6-(1-benzylpiperidin-4-yl)-4- ethylmorpholin-3-one::US10421750, Example 41	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413905	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413905&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073794	433914004							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826073	CCN1CC(OC2(CC2)C1=O)C1CN(Cc2ccccc2)C1	InChI=1S/C18H24N2O2/c1-2-20-13-16(22-18(8-9-18)17(20)21)15-11-19(12-15)10-14-6-4-3-5-7-14/h3-7,15-16H,2,8-13H2,1H3	MQOUBEVVYNCWGX-UHFFFAOYSA-N	413906	5-(1-benzylazetidin-3-yl)-7-ethyl-4- oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 42	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413906	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413906&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073795	433914005							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826074	CCN1CC(OC2(CC2)C1=O)C1CN(CCc2ccccc2)C1	InChI=1S/C19H26N2O2/c1-2-21-14-17(23-19(9-10-19)18(21)22)16-12-20(13-16)11-8-15-6-4-3-5-7-15/h3-7,16-17H,2,8-14H2,1H3	WUDARJABLCKMBS-UHFFFAOYSA-N	413907	7-ethyl-5-(1-phenethylazetidin-3- yl)-4-oxa-7-azaspiro[2.5]octan-8- one::US10421750, Example 43	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413907	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413907&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073793	433914006							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826075	CC(C)CCN1CCC(CC1)C1CN(C(=O)C2(CC2)O1)c1ccccc1	InChI=1S/C22H32N2O2/c1-17(2)8-13-23-14-9-18(10-15-23)20-16-24(19-6-4-3-5-7-19)21(25)22(26-20)11-12-22/h3-7,17-18,20H,8-16H2,1-2H3	MMUHGDAQLWZPPZ-UHFFFAOYSA-N	413908	5-(1-isopentylpiperidin-4-yl)-7- phenyl-4-oxa-7- azaspiro[2.5]octan-8-one::US10421750, Example 44	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413908	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413908&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129073931	433914007							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826076	O=C1N(CC(OC11CC1)C1CN(Cc2ccccc2)C1)c1ccccc1	InChI=1S/C22H24N2O2/c25-21-22(11-12-22)26-20(16-24(21)19-9-5-2-6-10-19)18-14-23(15-18)13-17-7-3-1-4-8-17/h1-10,18,20H,11-16H2	JNYXEIDCDMSXIF-UHFFFAOYSA-N	413909	5-(1-benzylazetidin-3-yl)-7-phenyl- 4-oxa-7-azaspiro[2.5]octan-8-one::US10421750, Example 45	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413909	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413909&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053754	433914008							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826077	COc1ccc(CN2CC(OC3(CC3)C2)C2CCN(CC(C)C)CC2)cc1	InChI=1S/C23H36N2O2/c1-18(2)14-24-12-8-20(9-13-24)22-16-25(17-23(27-22)10-11-23)15-19-4-6-21(26-3)7-5-19/h4-7,18,20,22H,8-17H2,1-3H3	XAHCHRAVXBNPSI-UHFFFAOYSA-N	413910	5-(1-isobutylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octane::US10421750, Example 46	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413910	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413910&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053845	433914009							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826078	COc1ccc(CN2CC(OC3(CC3)C2)C2CCN(CCC(C)C)CC2)cc1	InChI=1S/C24H38N2O2/c1-19(2)8-13-25-14-9-21(10-15-25)23-17-26(18-24(28-23)11-12-24)16-20-4-6-22(27-3)7-5-20/h4-7,19,21,23H,8-18H2,1-3H3	MAFPRDWAKWTLHR-UHFFFAOYSA-N	413911	5-(1-isopentylpiperidin-4-yl)-7-(4- methoxybenzyl)-4-oxa-7- azaspiro[2.5]octane::US10421750, Example 47	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413911	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413911&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053735	433914010							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826079	CCN1CC(OC2(CC2)C1)C1CCN(CCC(C)C)CC1	InChI=1S/C18H34N2O/c1-4-19-13-17(21-18(14-19)8-9-18)16-6-11-20(12-7-16)10-5-15(2)3/h15-17H,4-14H2,1-3H3	SYRMTRJVSFHGGC-UHFFFAOYSA-N	413912	7-ethyl-5-(1-isopentylpiperidin-4- yl)-4-oxa-7-azaspiro[2.5]actane::US10421750, Example 48	Sigma non-opioid intracellular receptor 1	Homo sapiens	<500								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413912	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413912&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053748	433914011							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826080	COc1ccc(CN2CCOC(C2)C2CCN(Cc3ccccc3)CC2)cc1	InChI=1S/C24H32N2O2/c1-27-23-9-7-21(8-10-23)18-26-15-16-28-24(19-26)22-11-13-25(14-12-22)17-20-5-3-2-4-6-20/h2-10,22,24H,11-19H2,1H3	FVRRYAWBHZXWME-UHFFFAOYSA-N	413913	2-(1-benzylpiperidin-4-yl)-4-(4- methoxybenzyl)moropholine::US10421750, Example 49	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413913	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413913&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053759	433914012							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826081	CCN1CCOC(C1)C1CCN(Cc2ccccc2)CC1	InChI=1S/C18H28N2O/c1-2-19-12-13-21-18(15-19)17-8-10-20(11-9-17)14-16-6-4-3-5-7-16/h3-7,17-18H,2,8-15H2,1H3	WPGVWKPTXFCTDU-UHFFFAOYSA-N	413914	2-(1-benzylpiperidin-4-yl)-4- ethylmorpholine::US10421750, Example 50	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413914	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413914&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053792	433914013							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
826082	CC(C)CCN1CCC(CC1)C1CN(CC2(CC2)O1)C(=O)c1ccccc1	InChI=1S/C23H34N2O2/c1-18(2)8-13-24-14-9-19(10-15-24)21-16-25(17-23(27-21)11-12-23)22(26)20-6-4-3-5-7-20/h3-7,18-19,21H,8-17H2,1-2H3	KXDBNEUTCNXTCN-UHFFFAOYSA-N	413915	(5-(1-Isopentylpiperidin-4-yl)-4- oxa-7-azaspiro[2.5]octan-7- yl)(phenyl)methanone::US10421750, Example 51	Sigma non-opioid intracellular receptor 1	Homo sapiens	<100								US Patent		10.7270/Q2TB197R		aid1803838	US10421750	Virgili-Bernado, M; Alegret-Molina, C	9/24/2019	8/12/2020	ESTEVE PHARMACEUTICALS, S.A.	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=413915	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=413915&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search			129053765	433914014							1	MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP	5HK1,5HK2,6DJZ,6DK0,6DK1	Sigma non-opioid intracellular receptor 1	SGMR1_HUMAN	Q99720	D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0