BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
805770	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cccc(CO)c3F)c2c(=O)n(C)c1=O	InChI=1S/C24H27FN4O3S/c1-12(2)10-29-23-20(22(31)28(5)24(29)32)19(16-8-6-7-15(11-30)21(16)25)18(33-23)9-17-13(3)26-27-14(17)4/h6-8,12,30H,9-11H2,1-5H3,(H,26,27)	VGXVSHJDGJTLJG-UHFFFAOYSA-N	402876	US10329303, Example 1	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=402876	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=402876&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122432416	405262855							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805771	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(C)cc(CO)c3F)c2c(=O)n(C)c1=O	InChI=1S/C25H29FN4O3S/c1-12(2)10-30-24-21(23(32)29(6)25(30)33)20(18-8-13(3)7-16(11-31)22(18)26)19(34-24)9-17-14(4)27-28-15(17)5/h7-8,12,31H,9-11H2,1-6H3,(H,27,28)	FYAQNUUFGKLTNB-UHFFFAOYSA-N	402882	US10329303, Example 2	Malignant T-cell-amplified sequence 1	Human				 100.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=402882	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=402882&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401628	405262861							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805772	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3c(F)cc(F)c(CO)c3F)c2c(=O)n(C)c1=O	InChI=1S/C24H25F3N4O3S/c1-10(2)8-31-23-20(22(33)30(5)24(31)34)19(17(35-23)6-13-11(3)28-29-12(13)4)18-16(26)7-15(25)14(9-32)21(18)27/h7,10,32H,6,8-9H2,1-5H3,(H,28,29)	JDFHDAQQHRCWFY-UHFFFAOYSA-N	402974	US10329303, Example 3	Malignant T-cell-amplified sequence 1	Human				 5500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=402974	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=402974&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401631	405262951							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805773	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cnc(F)c(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C23H26FN5O3S/c1-11(2)9-29-22-19(21(31)28(5)23(29)32)18(14-6-15(10-30)20(24)25-8-14)17(33-22)7-16-12(3)26-27-13(16)4/h6,8,11,30H,7,9-10H2,1-5H3,(H,26,27)	SOSFMQAUOYIHQR-UHFFFAOYSA-N	402975	US10329303, Example 4	Malignant T-cell-amplified sequence 1	Human				 200					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=402975	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=402975&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401613	405262952							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805774	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(F)c(F)c(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C24H26F2N4O3S/c1-11(2)9-30-23-20(22(32)29(5)24(30)33)19(14-6-15(10-31)21(26)17(25)7-14)18(34-23)8-16-12(3)27-28-13(16)4/h6-7,11,31H,8-10H2,1-5H3,(H,27,28)	RIZQMCNEYDNEFY-UHFFFAOYSA-N	403025	US10329303, Example 5	Malignant T-cell-amplified sequence 1	Human				 160					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403025	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403025&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			73508028	405263001							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805775	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(CO)c(F)cc3F)c2c(=O)n(C)c1=O	InChI=1S/C24H26F2N4O3S/c1-11(2)9-30-23-21(22(32)29(5)24(30)33)20(16-6-14(10-31)17(25)8-18(16)26)19(34-23)7-15-12(3)27-28-13(15)4/h6,8,11,31H,7,9-10H2,1-5H3,(H,27,28)	AHLURGFBUMDAFW-UHFFFAOYSA-N	403040	US10329303, Example 6	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403040	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403040&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			73438602	405263016							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805776	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccc(F)c(CO)c3F)c2c(=O)n(C)c1=O	InChI=1S/C24H26F2N4O3S/c1-11(2)9-30-23-20(22(32)29(5)24(30)33)19(14-6-7-17(25)16(10-31)21(14)26)18(34-23)8-15-12(3)27-28-13(15)4/h6-7,11,31H,8-10H2,1-5H3,(H,27,28)	HRUHNBHIUSQWBT-UHFFFAOYSA-N	403041	US10329303, Example 7	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403041	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403041&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424393	405263017							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805777	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cncc(c3)C(O)C(F)(F)F)c2c(=O)n(C)c1=O	InChI=1S/C24H26F3N5O3S/c1-11(2)10-32-22-19(21(34)31(5)23(32)35)18(17(36-22)7-16-12(3)29-30-13(16)4)14-6-15(9-28-8-14)20(33)24(25,26)27/h6,8-9,11,20,33H,7,10H2,1-5H3,(H,29,30)	GUECJEUCWGAKSH-UHFFFAOYSA-N	403059	US10329303, Example 8	Malignant T-cell-amplified sequence 1	Human				 34.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403059	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403059&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401616	405263035							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805778	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccc(F)c(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C24H27FN4O3S/c1-12(2)10-29-23-21(22(31)28(5)24(29)32)20(15-6-7-18(25)16(8-15)11-30)19(33-23)9-17-13(3)26-27-14(17)4/h6-8,12,30H,9-11H2,1-5H3,(H,26,27)	UDULIHXORZBJCF-UHFFFAOYSA-N	403093	US10329303, Example 9	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403093	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403093&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424320	405263068							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805779	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccnc(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C23H27N5O3S/c1-12(2)10-28-22-20(21(30)27(5)23(28)31)19(15-6-7-24-16(8-15)11-29)18(32-22)9-17-13(3)25-26-14(17)4/h6-8,12,29H,9-11H2,1-5H3,(H,25,26)	XWQOAHYLZSHHFN-UHFFFAOYSA-N	403094	US10329303, Example 10	Malignant T-cell-amplified sequence 1	Human				 90.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403094	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403094&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424217	405263069							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805780	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(F)cc(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C24H27FN4O3S/c1-12(2)10-29-23-21(22(31)28(5)24(29)32)20(16-6-15(11-30)7-17(25)8-16)19(33-23)9-18-13(3)26-27-14(18)4/h6-8,12,30H,9-11H2,1-5H3,(H,26,27)	PIYNXYNEOZTURP-UHFFFAOYSA-N	403095	US10329303, Example 11	Malignant T-cell-amplified sequence 1	Human				 25.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403095	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403095&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424452	405263070							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805781	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cncc(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C23H27N5O3S/c1-12(2)10-28-22-20(21(30)27(5)23(28)31)19(16-6-15(11-29)8-24-9-16)18(32-22)7-17-13(3)25-26-14(17)4/h6,8-9,12,29H,7,10-11H2,1-5H3,(H,25,26)	LFAQGQBGEOSMCO-UHFFFAOYSA-N	403109	US10329303, Example 12	Malignant T-cell-amplified sequence 1	Human				 75.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403109	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403109&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424310	405263084							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805782	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cccc(c3)C(C)O)c2c(=O)n(C)c1=O	InChI=1S/C25H30N4O3S/c1-13(2)12-29-24-22(23(31)28(6)25(29)32)21(18-9-7-8-17(10-18)16(5)30)20(33-24)11-19-14(3)26-27-15(19)4/h7-10,13,16,30H,11-12H2,1-6H3,(H,26,27)	HKJANQZDSCTIQE-UHFFFAOYSA-N	403111	US10329303, Example 13	Malignant T-cell-amplified sequence 1	Human				 50.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403111	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403111&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424206	405263086							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805783	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cccc(c3)C(O)C(F)(F)F)c2c(=O)n(C)c1=O	InChI=1S/C25H27F3N4O3S/c1-12(2)11-32-23-20(22(34)31(5)24(32)35)19(18(36-23)10-17-13(3)29-30-14(17)4)15-7-6-8-16(9-15)21(33)25(26,27)28/h6-9,12,21,33H,10-11H2,1-5H3,(H,29,30)	XTRMKDQMRVDXNG-UHFFFAOYSA-N	403118	US10329303, Example 14	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403118	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403118&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424425	405263093							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805784	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cccc(CO)c3)c2c(=O)n(C)c1=O	InChI=1S/C24H28N4O3S/c1-13(2)11-28-23-21(22(30)27(5)24(28)31)20(17-8-6-7-16(9-17)12-29)19(32-23)10-18-14(3)25-26-15(18)4/h6-9,13,29H,10-12H2,1-5H3,(H,25,26)	CIZBUZHDLAOFMT-UHFFFAOYSA-N	403142	US10329303, Example 15	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403142	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403142&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424364	405263117							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805785	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccc(F)c(CO)c3)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H29FN4O3S/c1-13(2)11-30-25-23(24(33)31(26(30)34)18-6-7-18)22(16-5-8-20(27)17(9-16)12-32)21(35-25)10-19-14(3)28-29-15(19)4/h5,8-9,13,18,32H,6-7,10-12H2,1-4H3,(H,28,29)	QHJGPRJUXDPBKW-UHFFFAOYSA-N	403155	US10329303, Example 16	Malignant T-cell-amplified sequence 1	Human				 220					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403155	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403155&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401636	405263130							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805786	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(C)cc(CO)c3F)c2c(=O)n(C2CC2)c1=O	InChI=1S/C27H31FN4O3S/c1-13(2)11-31-26-23(25(34)32(27(31)35)18-6-7-18)22(20-9-14(3)8-17(12-33)24(20)28)21(36-26)10-19-15(4)29-30-16(19)5/h8-9,13,18,33H,6-7,10-12H2,1-5H3,(H,29,30)	BJEOKTREPBGOOA-UHFFFAOYSA-N	403158	US10329303, Example 17	Malignant T-cell-amplified sequence 1	Human				 100.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403158	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403158&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401617	405263133							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805787	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(F)c(F)c(CO)c3)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H28F2N4O3S/c1-12(2)10-31-25-22(24(34)32(26(31)35)17-5-6-17)21(15-7-16(11-33)23(28)19(27)8-15)20(36-25)9-18-13(3)29-30-14(18)4/h7-8,12,17,33H,5-6,9-11H2,1-4H3,(H,29,30)	IJOBUIMRLTUQSB-UHFFFAOYSA-N	403181	US10329303, Example 18	Malignant T-cell-amplified sequence 1	Human				 900					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403181	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403181&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			76401630	405254692							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805788	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(CO)c(F)cc3F)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H28F2N4O3S/c1-12(2)10-31-25-23(24(34)32(26(31)35)16-5-6-16)22(18-7-15(11-33)19(27)9-20(18)28)21(36-25)8-17-13(3)29-30-14(17)4/h7,9,12,16,33H,5-6,8,10-11H2,1-4H3,(H,29,30)	ZXVUDYHWDJMBQV-UHFFFAOYSA-N	403182	US10329303, Example 19	Malignant T-cell-amplified sequence 1	Human				 70.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403182	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403182&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			73438631	405254693							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805789	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cccc(CO)c3F)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H29FN4O3S/c1-13(2)11-30-25-22(24(33)31(26(30)34)17-8-9-17)21(18-7-5-6-16(12-32)23(18)27)20(35-25)10-19-14(3)28-29-15(19)4/h5-7,13,17,32H,8-12H2,1-4H3,(H,28,29)	OPYWASXPNJSDRH-UHFFFAOYSA-N	403184	US10329303, Example 20	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403184	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403184&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			73438625	405254695							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805790	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccc(F)c(CO)c3F)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H28F2N4O3S/c1-12(2)10-31-25-22(24(34)32(26(31)35)15-5-6-15)21(16-7-8-19(27)18(11-33)23(16)28)20(36-25)9-17-13(3)29-30-14(17)4/h7-8,12,15,33H,5-6,9-11H2,1-4H3,(H,29,30)	HVBRSJWWPTWSSF-UHFFFAOYSA-N	403188	US10329303, Example 21	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403188	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403188&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			73438611	405254699							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805791	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(CO)ccc3F)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H29FN4O3S/c1-13(2)11-30-25-23(24(33)31(26(30)34)17-6-7-17)22(19-9-16(12-32)5-8-20(19)27)21(35-25)10-18-14(3)28-29-15(18)4/h5,8-9,13,17,32H,6-7,10-12H2,1-4H3,(H,28,29)	CDRKBMSTLFRYKP-UHFFFAOYSA-N	403218	US10329303, Example 22	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403218	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403218&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424376	405254729							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805792	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccnc(CO)c3)c2c(=O)n(C2CC2)c1=O	InChI=1S/C25H29N5O3S/c1-13(2)11-29-24-22(23(32)30(25(29)33)18-5-6-18)21(16-7-8-26-17(9-16)12-31)20(34-24)10-19-14(3)27-28-15(19)4/h7-9,13,18,31H,5-6,10-12H2,1-4H3,(H,27,28)	AVTSVTSMJXPVLA-UHFFFAOYSA-N	403224	US10329303, Example 23	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403224	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403224&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424361	405254735							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805793	CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cccc(CO)c3)c2c(=O)n(C2CC2)c1=O	InChI=1S/C26H30N4O3S/c1-14(2)12-29-25-23(24(32)30(26(29)33)19-8-9-19)22(18-7-5-6-17(10-18)13-31)21(34-25)11-20-15(3)27-28-16(20)4/h5-7,10,14,19,31H,8-9,11-13H2,1-4H3,(H,27,28)	LCTBZOZGIJETSJ-UHFFFAOYSA-N	403225	US10329303, Example 24	Malignant T-cell-amplified sequence 1	Human				 1.000					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403225	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403225&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424387	405254736							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805794	CC(C)Cc1nn(C)c(=O)c2c(-c3ncc(CO)s3)n(Cc3cccc4ccccc34)cc12	InChI=1S/C26H26N4O2S/c1-16(2)11-22-21-14-30(13-18-9-6-8-17-7-4-5-10-20(17)18)24(23(21)26(32)29(3)28-22)25-27-12-19(15-31)33-25/h4-10,12,14,16,31H,11,13,15H2,1-3H3	APVMBADTVFKFHC-UHFFFAOYSA-N	403226	US10329303, Example 25	Malignant T-cell-amplified sequence 1	Human				 300					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403226	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403226&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424277	405254737							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805795	CC(C)Cc1nn(C)c(=O)c2c(-c3csc(CO)n3)n(Cc3cccc4ccccc34)cc12	InChI=1S/C26H26N4O2S/c1-16(2)11-21-20-13-30(12-18-9-6-8-17-7-4-5-10-19(17)18)25(22-15-33-23(14-31)27-22)24(20)26(32)29(3)28-21/h4-10,13,15-16,31H,11-12,14H2,1-3H3	RQXVTQBVRLDJRU-UHFFFAOYSA-N	403227	US10329303, Example 26	Malignant T-cell-amplified sequence 1	Human				 90.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403227	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403227&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424284	405254738							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805796	CC(C)Cc1nn(C)c(=O)c2c(-c3ccc(F)c(CO)c3F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C29H27F2N3O2/c1-17(2)13-25-22-15-34(14-19-9-6-8-18-7-4-5-10-20(18)19)28(26(22)29(36)33(3)32-25)21-11-12-24(30)23(16-35)27(21)31/h4-12,15,17,35H,13-14,16H2,1-3H3	VVRINDLTDVAMFF-UHFFFAOYSA-N	403228	US10329303, Example 27	Malignant T-cell-amplified sequence 1	Human				 80.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403228	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403228&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424339	405254739							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805797	CC(C)Cc1nn(C)c(=O)c2c(-c3cc(CO)ccc3F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C29H28FN3O2/c1-18(2)13-26-24-16-33(15-21-9-6-8-20-7-4-5-10-22(20)21)28(27(24)29(35)32(3)31-26)23-14-19(17-34)11-12-25(23)30/h4-12,14,16,18,34H,13,15,17H2,1-3H3	KEOBEEYUZMGKJN-UHFFFAOYSA-N	403229	US10329303, Example 28	Malignant T-cell-amplified sequence 1	Human				 40.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403229	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403229&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424229	405254740							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805798	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C29H28FN3O2/c1-18(2)14-25-24-16-33(15-20-10-6-9-19-8-4-5-12-22(19)20)28(26(24)29(35)32(3)31-25)23-13-7-11-21(17-34)27(23)30/h4-13,16,18,34H,14-15,17H2,1-3H3	LBUZZXKIDIYWKJ-UHFFFAOYSA-N	403230	US10329303, Example 29	Malignant T-cell-amplified sequence 1	Human				 80.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403230	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403230&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424410	405254741							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805799	CC(C)Cc1nn(C)c(=O)c2c(-c3cc(CO)ccc3Cl)n(Cc3cccc4ccccc34)cc12	InChI=1S/C29H28ClN3O2/c1-18(2)13-26-24-16-33(15-21-9-6-8-20-7-4-5-10-22(20)21)28(27(24)29(35)32(3)31-26)23-14-19(17-34)11-12-25(23)30/h4-12,14,16,18,34H,13,15,17H2,1-3H3	VVLFYEUQXXXBCB-UHFFFAOYSA-N	403231	US10329303, Example 30	Malignant T-cell-amplified sequence 1	Human				 600					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403231	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403231&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424345	405254742							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805800	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cccc4ccccc34)cc12	InChI=1S/C29H29N3O2/c1-19(2)14-26-25-17-32(16-23-12-7-10-21-9-4-5-13-24(21)23)28(27(25)29(34)31(3)30-26)22-11-6-8-20(15-22)18-33/h4-13,15,17,19,33H,14,16,18H2,1-3H3	YIKCNVVTMXFUGO-UHFFFAOYSA-N	403232	US10329303, Example 31	Malignant T-cell-amplified sequence 1	Human				 100.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403232	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403232&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424395	405254743							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805801	CC(C)Cc1nn(C)c(=O)c2c(-c3cncc(CO)c3)n(Cc3cccc4ccccc34)cc12	InChI=1S/C28H28N4O2/c1-18(2)11-25-24-16-32(15-21-9-6-8-20-7-4-5-10-23(20)21)27(26(24)28(34)31(3)30-25)22-12-19(17-33)13-29-14-22/h4-10,12-14,16,18,33H,11,15,17H2,1-3H3	ZYRFDMJISGNQAU-UHFFFAOYSA-N	403233	US10329303, Example 32	Malignant T-cell-amplified sequence 1	Human				 900					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403233	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403233&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424224	405254744							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805802	CC(C)Cc1nn(C)c(=O)c2c(-c3csc(c3)C(C)O)n(Cc3cccc4ccccc34)cc12	InChI=1S/C28H29N3O2S/c1-17(2)12-24-23-15-31(14-20-10-7-9-19-8-5-6-11-22(19)20)27(26(23)28(33)30(4)29-24)21-13-25(18(3)32)34-16-21/h5-11,13,15-18,32H,12,14H2,1-4H3	XXJZGVJVXLISJO-UHFFFAOYSA-N	403234	US10329303, Example 33	Malignant T-cell-amplified sequence 1	Human				 70.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403234	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403234&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424388	405254745							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805803	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(n3)C(C)O)n(Cc3cccc4ccccc34)cc12	InChI=1S/C29H30N4O2/c1-18(2)15-26-23-17-33(16-21-11-7-10-20-9-5-6-12-22(20)21)28(27(23)29(35)32(4)31-26)25-14-8-13-24(30-25)19(3)34/h5-14,17-19,34H,15-16H2,1-4H3	GMKHUKFHRUCUKS-UHFFFAOYSA-N	403235	US10329303, Example 34	Malignant T-cell-amplified sequence 1	Human				 1.000					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403235	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403235&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424253	405254746							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805804	CC(C)Cc1nn(C)c(=O)c2c(-c3cc(ccc3F)C(C)O)n(Cc3cccc4ccccc34)cc12	InChI=1S/C30H30FN3O2/c1-18(2)14-27-25-17-34(16-22-10-7-9-20-8-5-6-11-23(20)22)29(28(25)30(36)33(4)32-27)24-15-21(19(3)35)12-13-26(24)31/h5-13,15,17-19,35H,14,16H2,1-4H3	CZMUCXWTTRTTNP-UHFFFAOYSA-N	403236	US10329303, Example 35	Malignant T-cell-amplified sequence 1	Human				 80.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403236	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403236&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424259	405254747							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805805	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(c3)C(C)O)n(Cc3cccc4ccccc34)cc12	InChI=1S/C30H31N3O2/c1-19(2)15-27-26-18-33(17-24-13-7-10-21-9-5-6-14-25(21)24)29(28(26)30(35)32(4)31-27)23-12-8-11-22(16-23)20(3)34/h5-14,16,18-20,34H,15,17H2,1-4H3	TZORKFKCPLBUGB-UHFFFAOYSA-N	403237	US10329303, Example 36	Malignant T-cell-amplified sequence 1	Human				 100.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403237	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403237&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424386	405254748							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805806	CC(C)Cc1nn(C)c(=O)c2c(-c3csc(n3)C(O)C(F)(F)F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C27H25F3N4O2S/c1-15(2)11-20-19-13-34(12-17-9-6-8-16-7-4-5-10-18(16)17)23(22(19)26(36)33(3)32-20)21-14-37-25(31-21)24(35)27(28,29)30/h4-10,13-15,24,35H,11-12H2,1-3H3	DPCRWRMNMYLGMJ-UHFFFAOYSA-N	403238	US10329303, Example 37	Malignant T-cell-amplified sequence 1	Human				 100.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403238	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403238&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424200	405254749							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805807	CC(C)Cc1nn(C)c(=O)c2c(-c3csc(c3)C(O)C(F)(F)F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C28H26F3N3O2S/c1-16(2)11-22-21-14-34(13-18-9-6-8-17-7-4-5-10-20(17)18)25(24(21)27(36)33(3)32-22)19-12-23(37-15-19)26(35)28(29,30)31/h4-10,12,14-16,26,35H,11,13H2,1-3H3	DCKXKQKCPWUIPX-UHFFFAOYSA-N	403239	US10329303, Example 38	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403239	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403239&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424366	405254750							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805808	CC(C)Cc1nn(C)c(=O)c2c(-c3ccc(s3)C(O)C(F)(F)F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C28H26F3N3O2S/c1-16(2)13-21-20-15-34(14-18-9-6-8-17-7-4-5-10-19(17)18)25(24(20)27(36)33(3)32-21)22-11-12-23(37-22)26(35)28(29,30)31/h4-12,15-16,26,35H,13-14H2,1-3H3	DPJYQYUPNXNSCL-UHFFFAOYSA-N	403240	US10329303, Example 39	Malignant T-cell-amplified sequence 1	Human				 90.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403240	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403240&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424287	405254751							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805809	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(c3)C(O)C(F)(F)F)n(Cc3cccc4ccccc34)cc12	InChI=1S/C30H28F3N3O2/c1-18(2)14-25-24-17-36(16-22-12-6-9-19-8-4-5-13-23(19)22)27(26(24)29(38)35(3)34-25)20-10-7-11-21(15-20)28(37)30(31,32)33/h4-13,15,17-18,28,37H,14,16H2,1-3H3	BYHCZQHGSWVEEQ-UHFFFAOYSA-N	403241	US10329303, Example 40	Malignant T-cell-amplified sequence 1	Human				 50.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403241	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403241&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424337	405254752							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805810	CC(C)Cc1nn(C)c(=O)c2c(-c3cc(CO)ccc3F)n(Cc3ccc(cc3)-c3ccccc3)cc12	InChI=1S/C31H30FN3O2/c1-20(2)15-28-26-18-35(17-21-9-12-24(13-10-21)23-7-5-4-6-8-23)30(29(26)31(37)34(3)33-28)25-16-22(19-36)11-14-27(25)32/h4-14,16,18,20,36H,15,17,19H2,1-3H3	ZTMZHRHYRVRAQA-UHFFFAOYSA-N	403242	US10329303, Example 41	Malignant T-cell-amplified sequence 1	Human				 800					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403242	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403242&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122432427	405254753							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805811	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(c3)C(C)O)n(Cc3ccc(cc3)-c3ccccc3)cc12	InChI=1S/C32H33N3O2/c1-21(2)17-29-28-20-35(19-23-13-15-25(16-14-23)24-9-6-5-7-10-24)31(30(28)32(37)34(4)33-29)27-12-8-11-26(18-27)22(3)36/h5-16,18,20-22,36H,17,19H2,1-4H3	YPJDQOLERRCWNY-UHFFFAOYSA-N	403243	US10329303, Example 42	Malignant T-cell-amplified sequence 1	Human				 5500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403243	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403243&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122432428	405254754							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805812	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3c(C)n[nH]c3C)cc12	InChI=1S/C24H29N5O2/c1-14(2)9-21-20-12-29(11-19-15(3)25-26-16(19)4)23(22(20)24(31)28(5)27-21)18-8-6-7-17(10-18)13-30/h6-8,10,12,14,30H,9,11,13H2,1-5H3,(H,25,26)	GSRPEGWPUUFWLR-UHFFFAOYSA-N	403244	US10329303, Example 43	Malignant T-cell-amplified sequence 1	Human				 500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403244	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403244&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424215	405254755							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805813	CC(C)Cc1nn(C)c(=O)c2c(-c3cc(CO)ccc3F)n(Cc3c(C)n[nH]c3C)cc12	InChI=1S/C24H28FN5O2/c1-13(2)8-21-19-11-30(10-18-14(3)26-27-15(18)4)23(22(19)24(32)29(5)28-21)17-9-16(12-31)6-7-20(17)25/h6-7,9,11,13,31H,8,10,12H2,1-5H3,(H,26,27)	LETHMUFOTLCVET-UHFFFAOYSA-N	403245	US10329303, Example 44	Malignant T-cell-amplified sequence 1	Human				 200					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403245	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403245&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424232	405254756							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805814	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(c3)C(O)C(F)(F)F)n(Cc3c(C)n[nH]c3C)cc12	InChI=1S/C25H28F3N5O2/c1-13(2)9-20-19-12-33(11-18-14(3)29-30-15(18)4)22(21(19)24(35)32(5)31-20)16-7-6-8-17(10-16)23(34)25(26,27)28/h6-8,10,12-13,23,34H,9,11H2,1-5H3,(H,29,30)	GJYNLFLVZRKPLK-UHFFFAOYSA-N	403246	US10329303, Example 45	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403246	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403246&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424216	405254757							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805815	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cc(Cl)nc4ccccc34)cc12	InChI=1S/C28H27ClN4O2/c1-17(2)11-24-22-15-33(14-20-13-25(29)30-23-10-5-4-9-21(20)23)27(26(22)28(35)32(3)31-24)19-8-6-7-18(12-19)16-34/h4-10,12-13,15,17,34H,11,14,16H2,1-3H3	RPUVNRIBWQBPSO-UHFFFAOYSA-N	403247	US10329303, Example 46	Malignant T-cell-amplified sequence 1	Human				 5500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403247	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403247&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122432419	405254758							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805816	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cnc(Cl)c4ccccc34)cc12	InChI=1S/C28H27ClN4O2/c1-17(2)11-24-23-15-33(14-20-13-30-27(29)22-10-5-4-9-21(20)22)26(25(23)28(35)32(3)31-24)19-8-6-7-18(12-19)16-34/h4-10,12-13,15,17,34H,11,14,16H2,1-3H3	MASCIEJIJUOZHB-UHFFFAOYSA-N	403248	US10329303, Example 47	Malignant T-cell-amplified sequence 1	Human				 5500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403248	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403248&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424309	405254759							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805817	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(CCOc3ccccc3Cl)cc12	InChI=1S/C26H28ClN3O3/c1-17(2)13-22-20-15-30(11-12-33-23-10-5-4-9-21(23)27)25(24(20)26(32)29(3)28-22)19-8-6-7-18(14-19)16-31/h4-10,14-15,17,31H,11-13,16H2,1-3H3	ZXMYCLPXADAYIT-UHFFFAOYSA-N	403249	US10329303, Example 48	Malignant T-cell-amplified sequence 1	Human				 5500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403249	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403249&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			122424231	405254760							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805818	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cc(NCN)nc4ccccc34)cc12	InChI=1S/C29H32N6O2/c1-18(2)11-25-23-15-35(14-21-13-26(31-17-30)32-24-10-5-4-9-22(21)24)28(27(23)29(37)34(3)33-25)20-8-6-7-19(12-20)16-36/h4-10,12-13,15,18,36H,11,14,16-17,30H2,1-3H3,(H,31,32)	JNPSLMULPBWJJX-UHFFFAOYSA-N	403250	US10329303, Example 49	Malignant T-cell-amplified sequence 1	Human				 5500					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403250	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403250&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			132270545	405254761							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805819	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cnc(NCN)c4ccccc34)cc12	InChI=1S/C29H32N6O2/c1-18(2)11-25-24-15-35(14-21-13-31-28(32-17-30)23-10-5-4-9-22(21)23)27(26(24)29(37)34(3)33-25)20-8-6-7-19(12-20)16-36/h4-10,12-13,15,18,36H,11,14,16-17,30H2,1-3H3,(H,31,32)	ZPZSILFGTNAZRF-UHFFFAOYSA-N	403251	US10329303, Example 50	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403251	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403251&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			132270546	405254762							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805820	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cc(NCNC(C)=O)nc4ccccc34)cc12	InChI=1S/C31H34N6O3/c1-19(2)12-27-25-16-37(30(29(25)31(40)36(4)35-27)22-9-7-8-21(13-22)17-38)15-23-14-28(33-18-32-20(3)39)34-26-11-6-5-10-24(23)26/h5-11,13-14,16,19,38H,12,15,17-18H2,1-4H3,(H,32,39)(H,33,34)	QBCMEMJIWOAPSF-UHFFFAOYSA-N	403252	US10329303, Example 51	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403252	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403252&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			132270548	405254763							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
805821	CC(C)Cc1nn(C)c(=O)c2c(-c3cccc(CO)c3)n(Cc3cc(NCNC(=O)C(N)CCC(N)=O)nc4ccccc34)cc12	InChI=1S/C34H40N8O4/c1-20(2)13-28-25-17-42(32(31(25)34(46)41(3)40-28)22-8-6-7-21(14-22)18-43)16-23-15-30(39-27-10-5-4-9-24(23)27)37-19-38-33(45)26(35)11-12-29(36)44/h4-10,14-15,17,20,26,43H,11-13,16,18-19,35H2,1-3H3,(H2,36,44)(H,37,39)(H,38,45)	UANXWJKQUVXWSW-UHFFFAOYSA-N	403253	US10329303, Example 52	Malignant T-cell-amplified sequence 1	Human				<20.0					US Patent		10.7270/Q2B27XM9		aid1799360	US10329303	Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL	6/25/2019	5/31/2020	The Scripps Research Institute	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=403253	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=594&target=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=403253&enzyme=Malignant+T-cell-amplified+sequence+1&column=ki&startPg=0&Increment=50&submit=Search			132270547	405254764							1	MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK	5ONS,6MS4	Malignant T-cell-amplified sequence 1	MCTS1_HUMAN	Q9ULC4	B4DGY2 Q502X6