BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 545990 Cc1ccncc1-c1cn2cc(F)ccc2n1 InChI=1S/C13H10FN3/c1-9-4-5-15-6-11(9)12-8-17-7-10(14)2-3-13(17)16-12/h2-8H,1H3 OZFZGSMFPYQXCB-UHFFFAOYSA-N 286211 US9518055, Example 6::6-fluoro-2-(4-methylpyridin-3- yl)imidazo[1,2-a]pyridine Cytochrome P450 11B2, mitochondrial Human 22.4 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286211&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535685 378169806 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 545991 Cc1ccncc1-c1cn2cc(F)ccc2n1 InChI=1S/C13H10FN3/c1-9-4-5-15-6-11(9)12-8-17-7-10(14)2-3-13(17)16-12/h2-8H,1H3 OZFZGSMFPYQXCB-UHFFFAOYSA-N 286211 US9518055, Example 6::6-fluoro-2-(4-methylpyridin-3- yl)imidazo[1,2-a]pyridine Cytochrome P450 11B1, mitochondrial Human 63.0 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286211 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286211&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535685 378169806 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 545992 Cc1cncc(c1)-c1cn2cc(F)ccc2n1 InChI=1S/C13H10FN3/c1-9-4-10(6-15-5-9)12-8-17-7-11(14)2-3-13(17)16-12/h2-8H,1H3 XOJPENJNRHUDFU-UHFFFAOYSA-N 286214 US9518055, Example 7::6-fluoro-2-(5-methylpyridin-3- yl)imidazo[1,2-a]pyridine Cytochrome P450 11B2, mitochondrial Human 56.2 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286214&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535686 378169809 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 545993 Cc1cncc(c1)-c1cn2cc(F)ccc2n1 InChI=1S/C13H10FN3/c1-9-4-10(6-15-5-9)12-8-17-7-11(14)2-3-13(17)16-12/h2-8H,1H3 XOJPENJNRHUDFU-UHFFFAOYSA-N 286214 US9518055, Example 7::6-fluoro-2-(5-methylpyridin-3- yl)imidazo[1,2-a]pyridine Cytochrome P450 11B1, mitochondrial Human 60.0 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286214 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286214&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535686 378169809 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 545994 Cc1c(nc2ccc(C)cn12)-c1cnccc1C InChI=1S/C15H15N3/c1-10-4-5-14-17-15(12(3)18(14)9-10)13-8-16-7-6-11(13)2/h4-9H,1-3H3 JKAPIQCSOBKHFE-UHFFFAOYSA-N 286216 US9518055, Example 14::6-methyl-2-(6-methylpyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 9.10 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286216 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286216&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471861 378169811 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 545995 Cc1c(nc2ccc(C)cn12)-c1cnccc1C InChI=1S/C15H15N3/c1-10-4-5-14-17-15(12(3)18(14)9-10)13-8-16-7-6-11(13)2/h4-9H,1-3H3 JKAPIQCSOBKHFE-UHFFFAOYSA-N 286216 US9518055, Example 14::6-methyl-2-(6-methylpyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 2399 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286216 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286216&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471861 378169811 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 545996 Cc1c(nc2c(C)cccn12)-c1cnccc1C InChI=1S/C15H15N3/c1-10-6-7-16-9-13(10)14-12(3)18-8-4-5-11(2)15(18)17-14/h4-9H,1-3H3 KXTACOJVHAHFAU-UHFFFAOYSA-N 286218 US9518055, Example 15::8-methyl-2-(6-methylpyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 3.80 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286218 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286218&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471863 378169813 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 545997 Cc1c(nc2c(C)cccn12)-c1cnccc1C InChI=1S/C15H15N3/c1-10-6-7-16-9-13(10)14-12(3)18-8-4-5-11(2)15(18)17-14/h4-9H,1-3H3 KXTACOJVHAHFAU-UHFFFAOYSA-N 286218 US9518055, Example 15::8-methyl-2-(6-methylpyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 646 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286218 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286218&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471863 378169813 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 545998 Cc1c(nc2cc(C)ccn12)-c1cnccc1C InChI=1S/C15H15N3/c1-10-5-7-18-12(3)15(17-14(18)8-10)13-9-16-6-4-11(13)2/h4-9H,1-3H3 MURZJPCIAYYNPU-UHFFFAOYSA-N 286219 US9518055, Example 16::7-methyl-2-(6-methylpyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 204 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286219 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286219&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471864 378169814 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 545999 Cc1c(nc2cc(C)ccn12)-c1cnccc1C InChI=1S/C15H15N3/c1-10-5-7-18-12(3)15(17-14(18)8-10)13-9-16-6-4-11(13)2/h4-9H,1-3H3 MURZJPCIAYYNPU-UHFFFAOYSA-N 286219 US9518055, Example 16::7-methyl-2-(6-methylpyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 68.0 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286219 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286219&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471864 378169814 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546000 COc1cncc(c1)-c1nc2ccc(F)cn2c1C InChI=1S/C14H12FN3O/c1-9-14(10-5-12(19-2)7-16-6-10)17-13-4-3-11(15)8-18(9)13/h3-8H,1-2H3 SZBAIFHYRBMLFH-UHFFFAOYSA-N 286221 US9518055, Example 18::6-fluoro-3-methyl-2-(5- methoxypyridin-3- yl)imidazo[1,2-a]pyridine Cytochrome P450 11B2, mitochondrial Human 0.300 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286221 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286221&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535106 378169816 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546001 COc1cncc(c1)-c1nc2ccc(F)cn2c1C InChI=1S/C14H12FN3O/c1-9-14(10-5-12(19-2)7-16-6-10)17-13-4-3-11(15)8-18(9)13/h3-8H,1-2H3 SZBAIFHYRBMLFH-UHFFFAOYSA-N 286221 US9518055, Example 18::6-fluoro-3-methyl-2-(5- methoxypyridin-3- yl)imidazo[1,2-a]pyridine Cytochrome P450 11B1, mitochondrial Human 32.4 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286221 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286221&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535106 378169816 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546002 Cc1c(nc2ccc(F)cn12)-c1cncc(C)c1 InChI=1S/C14H12FN3/c1-9-5-11(7-16-6-9)14-10(2)18-8-12(15)3-4-13(18)17-14/h3-8H,1-2H3 SRZDNWBHPIJBNU-UHFFFAOYSA-N 286222 US9518055, Example 19::6-fluoro-3-methyl-2-(5- methylpyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 0.450 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286222 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286222&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535107 378169817 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546003 Cc1c(nc2ccc(F)cn12)-c1cncc(C)c1 InChI=1S/C14H12FN3/c1-9-5-11(7-16-6-9)14-10(2)18-8-12(15)3-4-13(18)17-14/h3-8H,1-2H3 SRZDNWBHPIJBNU-UHFFFAOYSA-N 286222 US9518055, Example 19::6-fluoro-3-methyl-2-(5- methylpyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 40.7 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286222 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286222&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535107 378169817 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546004 Cc1c(nc2ccc(F)cn12)-c1cnccc1C InChI=1S/C14H12FN3/c1-9-5-6-16-7-12(9)14-10(2)18-8-11(15)3-4-13(18)17-14/h3-8H,1-2H3 WPLGVWAMQYFEPG-UHFFFAOYSA-N 286223 US9518055, Example 20::6-fluoro-3-methyl-2-(4- methylpyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 2.20 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286223 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286223&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535393 378169818 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546005 Cc1c(nc2ccc(F)cn12)-c1cnccc1C InChI=1S/C14H12FN3/c1-9-5-6-16-7-12(9)14-10(2)18-8-11(15)3-4-13(18)17-14/h3-8H,1-2H3 WPLGVWAMQYFEPG-UHFFFAOYSA-N 286223 US9518055, Example 20::6-fluoro-3-methyl-2-(4- methylpyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 135 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286223 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286223&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535393 378169818 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546006 Cc1c(nc2ccc(F)cn12)-c1cncc2ccccc12 InChI=1S/C17H12FN3/c1-11-17(20-16-7-6-13(18)10-21(11)16)15-9-19-8-12-4-2-3-5-14(12)15/h2-10H,1H3 RYLIJQNPHJXVOG-UHFFFAOYSA-N 286224 US9518055, Example 25::4-(6-fluoro-3-ethylimidazo[1,2- a]pyridin-2-yl)isoquinoline Cytochrome P450 11B2, mitochondrial Human 0.100 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286224 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286224&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71506898 378169819 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546007 Cc1c(nc2ccc(F)cn12)-c1cncc2ccccc12 InChI=1S/C17H12FN3/c1-11-17(20-16-7-6-13(18)10-21(11)16)15-9-19-8-12-4-2-3-5-14(12)15/h2-10H,1H3 RYLIJQNPHJXVOG-UHFFFAOYSA-N 286224 US9518055, Example 25::4-(6-fluoro-3-ethylimidazo[1,2- a]pyridin-2-yl)isoquinoline Cytochrome P450 11B1, mitochondrial Human 14.8 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286224 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286224&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71506898 378169819 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546008 Cc1c(nc2cc(F)ccn12)-c1cncc(F)c1 InChI=1S/C13H9F2N3/c1-8-13(9-4-11(15)7-16-6-9)17-12-5-10(14)2-3-18(8)12/h2-7H,1H3 PZYANYLFDCQIJI-UHFFFAOYSA-N 286225 US9518055, Example 26::7-fluoro-2-(5-fluoropyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 4.70 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286225 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286225&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535108 378169820 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546009 Cc1c(nc2cc(F)ccn12)-c1cncc(F)c1 InChI=1S/C13H9F2N3/c1-8-13(9-4-11(15)7-16-6-9)17-12-5-10(14)2-3-18(8)12/h2-7H,1H3 PZYANYLFDCQIJI-UHFFFAOYSA-N 286225 US9518055, Example 26::7-fluoro-2-(5-fluoropyridin-3- yl)-3-methylimidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 912 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286225 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286225&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535108 378169820 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546010 Fc1ccc2nc(c(C3CC3)n2c1)-c1cccnc1 InChI=1S/C15H12FN3/c16-12-5-6-13-18-14(11-2-1-7-17-8-11)15(10-3-4-10)19(13)9-12/h1-2,5-10H,3-4H2 JZHFBFYLCYWYRN-UHFFFAOYSA-N 286226 US9518055, Example 28::3-cyclopropyl-6-fluoro-2- (pyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 23.4 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286226 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286226&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535681 378169821 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546011 Fc1ccc2nc(c(C3CC3)n2c1)-c1cccnc1 InChI=1S/C15H12FN3/c16-12-5-6-13-18-14(11-2-1-7-17-8-11)15(10-3-4-10)19(13)9-12/h1-2,5-10H,3-4H2 JZHFBFYLCYWYRN-UHFFFAOYSA-N 286226 US9518055, Example 28::3-cyclopropyl-6-fluoro-2- (pyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 76.0 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286226 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286226&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535681 378169821 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546012 Cc1cncc(c1)-c1nc2ccc(F)cn2c1C1CC1 InChI=1S/C16H14FN3/c1-10-6-12(8-18-7-10)15-16(11-2-3-11)20-9-13(17)4-5-14(20)19-15/h4-9,11H,2-3H2,1H3 MLZARUDBOJDNLR-UHFFFAOYSA-N 50206972 CHEMBL3911595::US9518055, Example 29 Cytochrome P450 11B2, mitochondrial Human 1.50 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206972 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206972&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535395 375981380 CHEMBL3911595 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546013 Cc1cncc(c1)-c1nc2ccc(F)cn2c1C1CC1 InChI=1S/C16H14FN3/c1-10-6-12(8-18-7-10)15-16(11-2-3-11)20-9-13(17)4-5-14(20)19-15/h4-9,11H,2-3H2,1H3 MLZARUDBOJDNLR-UHFFFAOYSA-N 50206972 CHEMBL3911595::US9518055, Example 29 Cytochrome P450 11B1, mitochondrial Human 589 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206972 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206972&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535395 375981380 CHEMBL3911595 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546014 Cc1ccncc1-c1nc2ccc(F)cn2c1C1CC1 InChI=1S/C16H14FN3/c1-10-6-7-18-8-13(10)15-16(11-2-3-11)20-9-12(17)4-5-14(20)19-15/h4-9,11H,2-3H2,1H3 AOWOOZVSVDTJLM-UHFFFAOYSA-N 286228 US9518055, Example 30::3-cyclopropyl-6-fluoro-2-(6- methylpyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B2, mitochondrial Human 3.20 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286228 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286228&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471695 378169823 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546015 Cc1ccncc1-c1nc2ccc(F)cn2c1C1CC1 InChI=1S/C16H14FN3/c1-10-6-7-18-8-13(10)15-16(11-2-3-11)20-9-12(17)4-5-14(20)19-15/h4-9,11H,2-3H2,1H3 AOWOOZVSVDTJLM-UHFFFAOYSA-N 286228 US9518055, Example 30::3-cyclopropyl-6-fluoro-2-(6- methylpyridin-3-yl)imidazo[1,2- a]pyridine Cytochrome P450 11B1, mitochondrial Human 1072 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286228 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286228&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 89471695 378169823 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546016 Fc1ccc2nc(c(C3CC3)n2c1)-c1cncc(F)c1 InChI=1S/C15H11F2N3/c16-11-3-4-13-19-14(10-5-12(17)7-18-6-10)15(9-1-2-9)20(13)8-11/h3-9H,1-2H2 VEYOJFZFZMQFIJ-UHFFFAOYSA-N 50206961 CHEMBL3893614::US9518055, Example 31 Cytochrome P450 11B2, mitochondrial Human 10.7 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206961 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206961&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535683 375981370 CHEMBL3893614 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546017 Fc1ccc2nc(c(C3CC3)n2c1)-c1cncc(F)c1 InChI=1S/C15H11F2N3/c16-11-3-4-13-19-14(10-5-12(17)7-18-6-10)15(9-1-2-9)20(13)8-11/h3-9H,1-2H2 VEYOJFZFZMQFIJ-UHFFFAOYSA-N 50206961 CHEMBL3893614::US9518055, Example 31 Cytochrome P450 11B1, mitochondrial Human 67.0 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206961 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206961&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535683 375981370 CHEMBL3893614 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546018 COc1cncc(c1)-c1nc2ccc(F)cn2c1C1CC1 InChI=1S/C16H14FN3O/c1-21-13-6-11(7-18-8-13)15-16(10-2-3-10)20-9-12(17)4-5-14(20)19-15/h4-10H,2-3H2,1H3 JQZNZPQADFOCLV-UHFFFAOYSA-N 50206969 CHEMBL3930572::US9518055, Example 34 Cytochrome P450 11B2, mitochondrial Human 4.50 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206969 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206969&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535398 375981377 CHEMBL3930572 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546019 COc1cncc(c1)-c1nc2ccc(F)cn2c1C1CC1 InChI=1S/C16H14FN3O/c1-21-13-6-11(7-18-8-13)15-16(10-2-3-10)20-9-12(17)4-5-14(20)19-15/h4-10H,2-3H2,1H3 JQZNZPQADFOCLV-UHFFFAOYSA-N 50206969 CHEMBL3930572::US9518055, Example 34 Cytochrome P450 11B1, mitochondrial Human 759 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206969 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206969&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535398 375981377 CHEMBL3930572 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546020 Fc1ccc2nc(c(C3CC3)n2c1)-c1cncc(c1)C(F)(F)F InChI=1S/C16H11F4N3/c17-12-3-4-13-22-14(15(9-1-2-9)23(13)8-12)10-5-11(7-21-6-10)16(18,19)20/h3-9H,1-2H2 IRYAGXNONLSWLK-UHFFFAOYSA-N 50206957 CHEMBL3902584::US9518055, Example 35 Cytochrome P450 11B2, mitochondrial Human 7.10 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206957 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206957&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535399 375981367 CHEMBL3902584 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546021 Fc1ccc2nc(c(C3CC3)n2c1)-c1cncc(c1)C(F)(F)F InChI=1S/C16H11F4N3/c17-12-3-4-13-22-14(15(9-1-2-9)23(13)8-12)10-5-11(7-21-6-10)16(18,19)20/h3-9H,1-2H2 IRYAGXNONLSWLK-UHFFFAOYSA-N 50206957 CHEMBL3902584::US9518055, Example 35 Cytochrome P450 11B1, mitochondrial Human 1023 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206957 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206957&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535399 375981367 CHEMBL3902584 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546022 CC(O)(c1cncc(c1)-c1nc2ccc(F)cn2c1C1CC1)C(F)(F)F InChI=1S/C18H15F4N3O/c1-17(26,18(20,21)22)12-6-11(7-23-8-12)15-16(10-2-3-10)25-9-13(19)4-5-14(25)24-15/h4-10,26H,2-3H2,1H3 OWGUKRPUVVBJPH-UHFFFAOYSA-N 286237 US9518055, Example 38::2-(5-(3-cyclopropyl-6- fluoroimidazo[1,2-a]pyridin-2- yl)pyridin-3-yl)-1,1,1- trifluoropropan-2-ol Cytochrome P450 11B2, mitochondrial Human 6.30 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286237 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286237&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535397 378169832 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546023 CC(O)(c1cncc(c1)-c1nc2ccc(F)cn2c1C1CC1)C(F)(F)F InChI=1S/C18H15F4N3O/c1-17(26,18(20,21)22)12-6-11(7-23-8-12)15-16(10-2-3-10)25-9-13(19)4-5-14(25)24-15/h4-10,26H,2-3H2,1H3 OWGUKRPUVVBJPH-UHFFFAOYSA-N 286237 US9518055, Example 38::2-(5-(3-cyclopropyl-6- fluoroimidazo[1,2-a]pyridin-2- yl)pyridin-3-yl)-1,1,1- trifluoropropan-2-ol Cytochrome P450 11B1, mitochondrial Human 1122 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286237 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286237&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535397 378169832 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546024 Fc1ccc2nc(c(C3CC3)n2c1)-c1cncc2ccccc12 InChI=1S/C19H14FN3/c20-14-7-8-17-22-18(19(12-5-6-12)23(17)11-14)16-10-21-9-13-3-1-2-4-15(13)16/h1-4,7-12H,5-6H2 VSSMWFPLHKIWCP-UHFFFAOYSA-N 50206963 CHEMBL3948337::US9518055, Example 41 Cytochrome P450 11B2, mitochondrial Human 0.500 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206963&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535400 375981372 CHEMBL3948337 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546025 Fc1ccc2nc(c(C3CC3)n2c1)-c1cncc2ccccc12 InChI=1S/C19H14FN3/c20-14-7-8-17-22-18(19(12-5-6-12)23(17)11-14)16-10-21-9-13-3-1-2-4-15(13)16/h1-4,7-12H,5-6H2 VSSMWFPLHKIWCP-UHFFFAOYSA-N 50206963 CHEMBL3948337::US9518055, Example 41 Cytochrome P450 11B1, mitochondrial Human 57.5 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50206963 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50206963&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535400 375981372 CHEMBL3948337 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2 546026 Fc1cccn2c(C3CC3)c(nc12)-c1cncc2ccccc12 InChI=1S/C19H14FN3/c20-16-6-3-9-23-18(12-7-8-12)17(22-19(16)23)15-11-21-10-13-4-1-2-5-14(13)15/h1-6,9-12H,7-8H2 JKSXZWXLFVIZOH-UHFFFAOYSA-N 286240 US9518055, Example 44::4-(3-cyclopropyl-8- fluoroimidazo[1,2-a]pyridin-2- yl)isoquinoline Cytochrome P450 11B2, mitochondrial Human 14.5 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286240 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=555&target=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286240&enzyme=Cytochrome+P450+11B2%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535684 378169835 1 MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN Cytochrome P450 11B2, mitochondrial C11B2_HUMAN P19099 B0ZBE4 Q16726 546027 Fc1cccn2c(C3CC3)c(nc12)-c1cncc2ccccc12 InChI=1S/C19H14FN3/c20-16-6-3-9-23-18(12-7-8-12)17(22-19(16)23)15-11-21-10-13-4-1-2-5-14(13)15/h1-6,9-12H,7-8H2 JKSXZWXLFVIZOH-UHFFFAOYSA-N 286240 US9518055, Example 44::4-(3-cyclopropyl-8- fluoroimidazo[1,2-a]pyridin-2- yl)isoquinoline Cytochrome P450 11B1, mitochondrial Human 2188 US Patent 10.7270/Q23B625B aid1795720 US9518055 Ali, A; Bennett, DJ; Cai, J; Carswell, E; Cooke, A; Hoyt, SB; Lo, M; London, C; MacLean, J; Park, MK; Ratcliffe, P; Taylor, JA; Whitehead, B; Xiong, Y 12/13/2016 1/14/2019 Merck Sharp & Dohme http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=286240 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=1022&target=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=286240&enzyme=Cytochrome+P450+11B1%2C+mitochondrial&column=ki&startPg=0&Increment=50&submit=Search 71535684 378169835 1 MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN Cytochrome P450 11B1, mitochondrial C11B1_HUMAN P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2