BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 453143 CC(F)(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259898 US9512115, 1 Glutaminyl-peptide cyclotransferase Homo sapiens 2.905 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259898 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259898&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 85469627 350084591 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453144 FC(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259899 US9512115, 2 Glutaminyl-peptide cyclotransferase Homo sapiens 8.5 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259899 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259899&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279226 350084592 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453145 CC(F)(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259900 US9512115, 3 Glutaminyl-peptide cyclotransferase Homo sapiens 5.0304 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259900 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259900&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279225 350084593 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453146 FC(F)CCOc1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259901 US9512115, 4 Glutaminyl-peptide cyclotransferase Homo sapiens 12.58 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259901 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259901&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90436372 350084594 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453147 CC(F)(F)COc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259902 US9512115, 5 Glutaminyl-peptide cyclotransferase Homo sapiens 21.266 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259902 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259902&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279287 350084595 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453148 CC(F)(F)COc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259903 US9512115, 6 Glutaminyl-peptide cyclotransferase Homo sapiens 6.207 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259903 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259903&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279286 350084596 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453149 CC(C)(F)COc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259904 US9512115, 7 Glutaminyl-peptide cyclotransferase Homo sapiens 9.8306 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259904 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259904&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 118699032 350084597 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453150 CC(F)(F)COc1c(F)cc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259905 US9512115, 8 Glutaminyl-peptide cyclotransferase Homo sapiens 25.952 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259905 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259905&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279288 350084598 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453151 CC(F)(F)CCOc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259906 US9512115, 10 Glutaminyl-peptide cyclotransferase Homo sapiens 8.9503 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259906 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259906&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90421543 350084599 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453152 FC(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259907 US9512115, 11 Glutaminyl-peptide cyclotransferase Homo sapiens 3.3447 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259907 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259907&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279290 350084600 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453153 FC(F)CCOc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259908 US9512115, 12 Glutaminyl-peptide cyclotransferase Homo sapiens 13.1 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259908 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259908&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279291 350084601 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453154 FC(F)CCOc1c(F)cc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259909 US9512115, 13 Glutaminyl-peptide cyclotransferase Homo sapiens 13.094 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259909 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259909&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279289 350084602 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453155 CC(F)(F)COc1ccc(cc1C#N)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259910 US9512115, 14 Glutaminyl-peptide cyclotransferase Homo sapiens 22.516 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259910 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259910&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279353 350084603 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453156 CC(F)(F)COc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(c1)C#N 259911 US9512115, 15 Glutaminyl-peptide cyclotransferase Homo sapiens 22.689 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259911 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259911&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279352 350084604 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453157 FC(F)CCCOc1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259912 US9512115, 16 Glutaminyl-peptide cyclotransferase Homo sapiens 15.955 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259912 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259912&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90436337 350084605 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453158 CC(F)(F)COc1cc(F)c([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259913 US9512115, 17 Glutaminyl-peptide cyclotransferase Homo sapiens 6.6648 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259913 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259913&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279355 350084606 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453159 Fc1cc(ccc1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)N1CCC(F)(F)C1 259914 US9512115, 18 Glutaminyl-peptide cyclotransferase Homo sapiens 2.6882 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259914 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259914&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279354 350084607 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453160 Fc1c(F)c(ccc1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)N1CCC(F)(F)C1 259915 US9512115, 19 Glutaminyl-peptide cyclotransferase Homo sapiens 2.4869 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259915 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259915&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279357 350084608 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453161 Fc1cc(cc(F)c1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)N1CCC(F)(F)C1 259916 US9512115, 20 Glutaminyl-peptide cyclotransferase Homo sapiens 4.5258 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259916 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259916&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279356 350084609 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453162 Fc1cc(ccc1N1CCC(F)(F)C1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259917 US9512115, 21 Glutaminyl-peptide cyclotransferase Homo sapiens 10.39 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259917 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259917&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279418 350084610 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453163 FC1(F)CCN(C1)c1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259918 US9512115, 22 Glutaminyl-peptide cyclotransferase Homo sapiens 20.445 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259918 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259918&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90436321 350084611 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453164 FC1(F)CCN(C1)c1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(c1)C#N 259919 US9512115, 23 Glutaminyl-peptide cyclotransferase Homo sapiens 5.1497 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259919 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259919&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279417 350084612 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453165 FC1(F)CCN(C1)c1ccc(cc1C#N)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259920 US9512115, 24 Glutaminyl-peptide cyclotransferase Homo sapiens 11.421 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259920 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259920&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279420 350084613 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453166 Fc1cc(ccc1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)C1CCC(F)(F)CC1 259921 US9512115, 25 Glutaminyl-peptide cyclotransferase Homo sapiens 9.2351 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259921 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259921&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279419 350084614 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453167 Fc1cc(ccc1C1CCC(F)(F)CC1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259922 US9512115, 26 Glutaminyl-peptide cyclotransferase Homo sapiens 13.56 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259922 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259922&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279422 350084615 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453168 FC1(F)CCC(CC1)c1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259923 US9512115, 27 Glutaminyl-peptide cyclotransferase Homo sapiens 15.4 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259923 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259923&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90421897 350084616 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453169 CC(F)(F)CCc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259924 US9512115, 28 Glutaminyl-peptide cyclotransferase Homo sapiens 23.8 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259924 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259924&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279421 350084617 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453170 CC(F)(F)CCc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259925 US9512115, 29 Glutaminyl-peptide cyclotransferase Homo sapiens 29.7 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259925 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259925&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279483 350084618 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453171 CC(F)(F)CCc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259926 US9512115, 30 Glutaminyl-peptide cyclotransferase Homo sapiens 12.033 6 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803667 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259926 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259926&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279484 350084619 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453172 CC(F)(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259898 US9512115, 1 Glutaminyl-peptide cyclotransferase Homo sapiens 3.5805 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259898 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259898&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 85469627 350084591 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453173 FC(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259899 US9512115, 2 Glutaminyl-peptide cyclotransferase Homo sapiens 6.5399 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259899 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259899&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279226 350084592 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453174 CC(F)(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259900 US9512115, 3 Glutaminyl-peptide cyclotransferase Homo sapiens 5.0169 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259900 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259900&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279225 350084593 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453175 FC(F)CCOc1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259901 US9512115, 4 Glutaminyl-peptide cyclotransferase Homo sapiens 17.823 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259901 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259901&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90436372 350084594 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453176 CC(F)(F)COc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259902 US9512115, 5 Glutaminyl-peptide cyclotransferase Homo sapiens 19.192 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259902 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259902&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279287 350084595 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453177 CC(F)(F)COc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259903 US9512115, 6 Glutaminyl-peptide cyclotransferase Homo sapiens 6.7076 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259903 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259903&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279286 350084596 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453178 CC(C)(F)COc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259904 US9512115, 7 Glutaminyl-peptide cyclotransferase Homo sapiens 10.871 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259904 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259904&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 118699032 350084597 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453179 CC(F)(F)COc1c(F)cc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259905 US9512115, 8 Glutaminyl-peptide cyclotransferase Homo sapiens 30.934 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259905 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259905&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279288 350084598 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453180 CC(F)(F)CCOc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259906 US9512115, 10 Glutaminyl-peptide cyclotransferase Homo sapiens 8.9859 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259906 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259906&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90421543 350084599 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453181 FC(F)CCOc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259907 US9512115, 11 Glutaminyl-peptide cyclotransferase Homo sapiens 5.54 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259907 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259907&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279290 350084600 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453182 FC(F)CCOc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259908 US9512115, 12 Glutaminyl-peptide cyclotransferase Homo sapiens 15.4 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259908 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259908&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279291 350084601 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453183 FC(F)CCOc1c(F)cc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259909 US9512115, 13 Glutaminyl-peptide cyclotransferase Homo sapiens 24.503 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259909 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259909&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279289 350084602 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453184 CC(F)(F)COc1ccc(cc1C#N)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259910 US9512115, 14 Glutaminyl-peptide cyclotransferase Homo sapiens 31.563 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259910 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259910&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279353 350084603 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453185 CC(F)(F)COc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(c1)C#N 259911 US9512115, 15 Glutaminyl-peptide cyclotransferase Homo sapiens 36.412 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259911 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259911&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279352 350084604 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453186 FC(F)CCCOc1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259912 US9512115, 16 Glutaminyl-peptide cyclotransferase Homo sapiens 22.111 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259912 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259912&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90436337 350084605 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453187 CC(F)(F)COc1cc(F)c([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259913 US9512115, 17 Glutaminyl-peptide cyclotransferase Homo sapiens 8.29 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259913 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259913&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279355 350084606 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453188 Fc1cc(ccc1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)N1CCC(F)(F)C1 259914 US9512115, 18 Glutaminyl-peptide cyclotransferase Homo sapiens 2.9232 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259914 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259914&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279354 350084607 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453189 Fc1c(F)c(ccc1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)N1CCC(F)(F)C1 259915 US9512115, 19 Glutaminyl-peptide cyclotransferase Homo sapiens 2.5297 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259915 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259915&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279357 350084608 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453190 Fc1cc(cc(F)c1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)N1CCC(F)(F)C1 259916 US9512115, 20 Glutaminyl-peptide cyclotransferase Homo sapiens 5.2928 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259916 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259916&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279356 350084609 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453191 Fc1cc(ccc1N1CCC(F)(F)C1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259917 US9512115, 21 Glutaminyl-peptide cyclotransferase Homo sapiens 16.668 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259917 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259917&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279418 350084610 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453192 FC1(F)CCN(C1)c1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259918 US9512115, 22 Glutaminyl-peptide cyclotransferase Homo sapiens 15.111 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259918 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259918&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90436321 350084611 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453193 FC1(F)CCN(C1)c1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(c1)C#N 259919 US9512115, 23 Glutaminyl-peptide cyclotransferase Homo sapiens 7.8928 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259919 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259919&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279417 350084612 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453194 FC1(F)CCN(C1)c1ccc(cc1C#N)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259920 US9512115, 24 Glutaminyl-peptide cyclotransferase Homo sapiens 15.542 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259920 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259920&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279420 350084613 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453195 Fc1cc(ccc1[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1)C1CCC(F)(F)CC1 259921 US9512115, 25 Glutaminyl-peptide cyclotransferase Homo sapiens 11.285 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259921 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259921&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279419 350084614 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453196 Fc1cc(ccc1C1CCC(F)(F)CC1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259922 US9512115, 26 Glutaminyl-peptide cyclotransferase Homo sapiens 14.325 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259922 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259922&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279422 350084615 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453197 FC1(F)CCC(CC1)c1ccc(cc1)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259923 US9512115, 27 Glutaminyl-peptide cyclotransferase Homo sapiens 44.3 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259923 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259923&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 90421897 350084616 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453198 CC(F)(F)CCc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1F 259924 US9512115, 28 Glutaminyl-peptide cyclotransferase Homo sapiens 14.9 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259924 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259924&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279421 350084617 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453199 CC(F)(F)CCc1ccc(cc1F)[C@H]1COC(=O)N1c1ccc2[nH]cnc2c1 259925 US9512115, 29 Glutaminyl-peptide cyclotransferase Homo sapiens 29.136 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259925 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259925&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279483 350084618 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 453200 CC(F)(F)CCc1ccc([C@H]2COC(=O)N2c2ccc3[nH]cnc3c2)c(F)c1 259926 US9512115, 30 Glutaminyl-peptide cyclotransferase Homo sapiens 12.217 8 30.00 C US Patent 10.7270/Q2XK8DG4 aid1803668 US9512115 Heiser, U; Buchholz, M; Sommer, R; Meyer, A; Demuth, H 12/6/2016 11/27/2017 Probiodrug AG http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=259926 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=259926&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 86279484 350084619 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 2AFM,2AFO,2AFW,2AFX,2AFZ,3PBB,3SI0,6YI1,6YJY,7CM0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4