BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 434901 Cc1noc(C)c1-c1cc(c2nc(NCC3CC3)[nH]c2c1)S(=O)(=O)NC1CCCC1 InChI=1S/C21H27N5O3S/c1-12-19(13(2)29-25-12)15-9-17-20(24-21(23-17)22-11-14-7-8-14)18(10-15)30(27,28)26-16-5-3-4-6-16/h9-10,14,16,26H,3-8,11H2,1-2H3,(H2,22,23,24) MEUUQDCOTOKHAT-UHFFFAOYSA-N 249273 US10017501, Compound 1020-1::US9458145, 1020-1 Bromodomain-containing protein 4 [75-147] Human 200.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249273 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249273&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282694 346543774 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434902 CSc1nc2c(cc(cc2[nH]1)-c1c(C)noc1C)S(=O)(=O)NC1CCCC1 InChI=1S/C18H22N4O3S2/c1-10-16(11(2)25-21-10)12-8-14-17(20-18(19-14)26-3)15(9-12)27(23,24)22-13-6-4-5-7-13/h8-9,13,22H,4-7H2,1-3H3,(H,19,20) LWWBJYKHKNDJHR-UHFFFAOYSA-N 249274 US10017501, Compound 1020-4::US9458145, 1020-4 Bromodomain-containing protein 4 [75-147] Human 336.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249274 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249274&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282835 346543775 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434903 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)S(C)=O)S(=O)(=O)NC1CCCC1 249275 US10017501, Compound 1020-5::US9458145, 1020-5 Bromodomain-containing protein 4 [75-147] Human 616.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249275 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249275&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282836 346543776 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434904 Cc1cnn(C)c1-c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C InChI=1S/C20H21N5O/c1-10-9-21-25(4)19(10)15-7-14(17-11(2)24-26-12(17)3)8-16-18(15)23-20(22-16)13-5-6-13/h7-9,13H,5-6H2,1-4H3,(H,22,23) NAHZVDUSKYOCRO-UHFFFAOYSA-N 249276 US10017501, Compound 1020-12::US9458145, 1020-12 Bromodomain-containing protein 4 [75-147] Human 137.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249276 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249276&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689344 346543777 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434905 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2[nH]c(nc2c1)C1CC1 InChI=1S/C25H22N4O/c1-13-6-9-20-18(5-4-10-26-20)22(13)19-11-17(23-14(2)29-30-15(23)3)12-21-24(19)28-25(27-21)16-7-8-16/h4-6,9-12,16H,7-8H2,1-3H3,(H,27,28) KHQQNXFBTALTQF-UHFFFAOYSA-N 249277 US10017501, Compound 1020-18::US9458145, 1020-18 Bromodomain-containing protein 4 [75-147] Human 87.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249277 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249277&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86301666 346543778 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434906 Cc1noc(C)c1-c1cc(-c2cccnc2-c2ccccc2)c2nc([nH]c2c1)C1CC1 InChI=1S/C26H22N4O/c1-15-23(16(2)31-30-15)19-13-21(25-22(14-19)28-26(29-25)18-10-11-18)20-9-6-12-27-24(20)17-7-4-3-5-8-17/h3-9,12-14,18H,10-11H2,1-2H3,(H,28,29) ZTTDZAWIKNDGPB-UHFFFAOYSA-N 249278 US10017501, Compound 1020-19::US9458145, 1020-19 Bromodomain-containing protein 4 [75-147] Human 134.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249278 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249278&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282285 346543779 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434907 CC\C=C(/CC)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C InChI=1S/C21H25N3O/c1-5-7-14(6-2)17-10-16(19-12(3)24-25-13(19)4)11-18-20(17)23-21(22-18)15-8-9-15/h7,10-11,15H,5-6,8-9H2,1-4H3,(H,22,23)/b14-7+ FIDCRXXEFWLWFD-VGOFMYFVSA-N 249279 US10017501, Compound 1020-28::US9458145, 1020-28 Bromodomain-containing protein 4 [75-147] Human 71.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249279 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249279&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86280791 346543780 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434908 Cc1noc(C)c1-c1cc(\C=C\c2ccccc2)c2[nH]c(nc2c1)C1CC1 InChI=1S/C23H21N3O/c1-14-21(15(2)27-26-14)19-12-18(9-8-16-6-4-3-5-7-16)22-20(13-19)24-23(25-22)17-10-11-17/h3-9,12-13,17H,10-11H2,1-2H3,(H,24,25)/b9-8+ ZHEKNGPBYHOWGN-CMDGGOBGSA-N 249280 US10017501, Compound 1020-37::US9458145, 1020-37 Bromodomain-containing protein 4 [75-147] Human 2089.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249280 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249280&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281607 346543781 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434909 CC(c1ccc(F)cc1)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C 249281 US10017501, Compound 1020-44::US9458145, 1020-44 Bromodomain-containing protein 4 [75-147] Human 139.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249281 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249281&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281737 346543782 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434910 Cc1noc(C)c1-c1cc(NC2CCCC2)c2nc([nH]c2c1)C1CC1 InChI=1S/C20H24N4O/c1-11-18(12(2)25-24-11)14-9-16(21-15-5-3-4-6-15)19-17(10-14)22-20(23-19)13-7-8-13/h9-10,13,15,21H,3-8H2,1-2H3,(H,22,23) UFMRZYYXPWVWNN-UHFFFAOYSA-N 249282 US10017501, Compound 1020-50::US9458145, 1020-50 Bromodomain-containing protein 4 [75-147] Human 299.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249282 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249282&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689239 346543783 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434911 Cc1noc(C)c1-c1cc(-c2c(C)ccnc2C)c2[nH]c(nc2c1)C1CC1 InChI=1S/C22H22N4O/c1-11-7-8-23-12(2)19(11)17-9-16(20-13(3)26-27-14(20)4)10-18-21(17)25-22(24-18)15-5-6-15/h7-10,15H,5-6H2,1-4H3,(H,24,25) PMNSTIGCGOIMNI-UHFFFAOYSA-N 249283 US10017501, Compound 1020-57::US9458145, 1020-57 Bromodomain-containing protein 4 [75-147] Human 109.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249283 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249283&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689290 346543784 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434912 Cc1n[nH]c(C)c1-c1cc(cc2nc(C3CC3)n(C)c12)-c1c(C)noc1C InChI=1S/C21H23N5O/c1-10-18(11(2)24-23-10)16-8-15(19-12(3)25-27-13(19)4)9-17-20(16)26(5)21(22-17)14-6-7-14/h8-9,14H,6-7H2,1-5H3,(H,23,24) QNBJGCLVDFUBMZ-UHFFFAOYSA-N 249284 US10017501, Compound 1020-72::US9458145, 1020-72 Bromodomain-containing protein 4 [75-147] Human 100.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249284 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249284&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689582 346543785 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434913 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2n(C)c(nc2c1)C1CC1 InChI=1S/C26H24N4O/c1-14-7-10-21-19(6-5-11-27-21)23(14)20-12-18(24-15(2)29-31-16(24)3)13-22-25(20)30(4)26(28-22)17-8-9-17/h5-7,10-13,17H,8-9H2,1-4H3 MDMMPXBYWBPZAT-UHFFFAOYSA-N 249285 US10017501, Compound 1020-74::US9458145, 1020-74 Bromodomain-containing protein 4 [75-147] Human 97.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249285 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249285&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282419 346543786 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434914 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C20H21N5O/c1-9-17(10(2)24-23-9)15-7-14(18-11(3)25-26-12(18)4)8-16-19(15)22-20(21-16)13-5-6-13/h7-8,13H,5-6H2,1-4H3,(H,21,22)(H,23,24) UVADONZESFBOCU-UHFFFAOYSA-N 249286 US9458145, 1020-75 Bromodomain-containing protein 4 [75-147] Human 120.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249286 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249286&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689434 346543787 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434915 Cc1nc2cc(cc(-c3c(C)n[nH]c3C)c2[nH]1)-c1c(C)noc1C InChI=1S/C18H19N5O/c1-8-16(9(2)22-21-8)14-6-13(17-10(3)23-24-11(17)4)7-15-18(14)20-12(5)19-15/h6-7H,1-5H3,(H,19,20)(H,21,22) VOTGXBKUYUWTOH-UHFFFAOYSA-N 249287 US10017501, Compound 1020-77::US9458145, 1020-77 Bromodomain-containing protein 4 [75-147] Human 244.5 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249287 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249287&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689723 346543788 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434916 Cc1n[nH]c(C)c1-c1cc(cc2nc([nH]c12)C1CC1(F)F)-c1c(C)noc1C InChI=1S/C20H17F2N5O/c1-8-16(9(2)26-25-8)13-5-12(17-10(3)27-28-11(17)4)6-15-18(13)24-19(23-15)14-7-20(14,21)22/h5-6,14H,7H2,1-4H3 RMCZCJRPBQPLJA-UHFFFAOYSA-N 249288 US10017501, Compound 1020-78::US9458145, 1020-78 Bromodomain-containing protein 4 [75-147] Human 160.5 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249288 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249288&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689237 346543789 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434917 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(NCC3CC3)nc12)-c1c(C)noc1C InChI=1S/C21H24N6O/c1-10-18(11(2)26-25-10)16-7-15(19-12(3)27-28-13(19)4)8-17-20(16)24-21(23-17)22-9-14-5-6-14/h7-8,14H,5-6,9H2,1-4H3,(H,25,26)(H2,22,23,24) CBKDXQMZHYYTEI-UHFFFAOYSA-N 249289 US10017501, Compound 1020-79::US9458145, 1020-79 Bromodomain-containing protein 4 [75-147] Human 161.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249289 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249289&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689315 346543790 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434918 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(NC3CC3)nc12)-c1c(C)noc1C InChI=1S/C20H22N6O/c1-9-17(10(2)25-24-9)15-7-13(18-11(3)26-27-12(18)4)8-16-19(15)23-20(22-16)21-14-5-6-14/h7-8,14H,5-6H2,1-4H3,(H,24,25)(H2,21,22,23) CPQRZDPSADFJEU-UHFFFAOYSA-N 249290 US10017501, Compound 1020-81::US9458145, 1020-81 Bromodomain-containing protein 4 [75-147] Human 168.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249290 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249290&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689658 346543791 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434919 Cc1noc(C)c1-c1cc(-c2c(C)ccnc2C)c2nc[nH]c2c1 InChI=1S/C19H18N4O/c1-10-5-6-20-11(2)17(10)15-7-14(8-16-19(15)22-9-21-16)18-12(3)23-24-13(18)4/h5-9H,1-4H3,(H,21,22) PNNSPWUDQDPRGS-UHFFFAOYSA-N 249291 US10017501, Compound 1020-84::US9458145, 1020-84 Bromodomain-containing protein 4 [75-147] Human 481.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249291 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249291&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282420 346543792 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434920 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)-c1cnn(C)c1 InChI=1S/C26H22N6O/c1-14-7-8-21-19(6-5-9-27-21)23(14)20-10-17(24-15(2)31-33-16(24)3)11-22-25(20)30-26(29-22)18-12-28-32(4)13-18/h5-13H,1-4H3,(H,29,30) VKCISKKMCAGVPR-UHFFFAOYSA-N 249292 US10017501, Compound 1020-88::US9458145, 1020-88 Bromodomain-containing protein 4 [75-147] Human 104.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249292 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249292&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282555 346543793 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434921 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)C(O)CCO 249293 US10017501, Compound 1020-89::US9458145, 1020-89 Bromodomain-containing protein 4 [75-147] Human 379.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249293 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249293&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689407 346543794 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434922 COc1nc2c(cc(cc2[nH]1)-c1c(C)noc1C)-c1c(C)ccc2ncccc12 InChI=1S/C23H20N4O2/c1-12-7-8-18-16(6-5-9-24-18)20(12)17-10-15(21-13(2)27-29-14(21)3)11-19-22(17)26-23(25-19)28-4/h5-11H,1-4H3,(H,25,26) ZHSYNUAULROSRV-UHFFFAOYSA-N 249294 US10017501, Compound 1020-90::US9458145, 1020-90 Bromodomain-containing protein 4 [75-147] Human 110.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249294 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249294&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689440 346543795 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434923 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)C(F)(F)F InChI=1S/C23H17F3N4O/c1-11-6-7-17-15(5-4-8-27-17)19(11)16-9-14(20-12(2)30-31-13(20)3)10-18-21(16)29-22(28-18)23(24,25)26/h4-10H,1-3H3,(H,28,29) XSOQPGCEEYGUOO-UHFFFAOYSA-N 249295 US10017501, Compound 1020-92::US9458145, 1020-92 Bromodomain-containing protein 4 [75-147] Human 133.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249295 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249295&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282422 346543796 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434924 Cc1n[nH]c(C)c1-c1cc(cc2nc(N)[nH]c12)-c1c(C)noc1C InChI=1S/C17H18N6O/c1-7-14(8(2)22-21-7)12-5-11(15-9(3)23-24-10(15)4)6-13-16(12)20-17(18)19-13/h5-6H,1-4H3,(H,21,22)(H3,18,19,20) PUWUOAONKKOSFC-UHFFFAOYSA-N 249296 US10017501, Compound 1020-96::US9458145, 1020-96 Bromodomain-containing protein 4 [75-147] Human 276.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249296 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249296&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689303 346543797 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434925 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1ccccc1 InChI=1S/C28H25N3O2/c1-17-25(18(2)33-31-17)20-15-23(26-24(16-20)29-27(30-26)19-13-14-19)28(32,21-9-5-3-6-10-21)22-11-7-4-8-12-22/h3-12,15-16,19,32H,13-14H2,1-2H3,(H,29,30) VCOPOFJUYXUWQK-UHFFFAOYSA-N 249297 US10017501, Compound 1020-102::US9458145, 1020-102 Bromodomain-containing protein 4 [75-147] Human 101.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249297 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249297&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281080 346543798 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434926 CCC(CC)c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C20H25N3O/c1-5-13(6-2)16-9-15(18-11(3)23-24-12(18)4)10-17-19(16)22-20(21-17)14-7-8-14/h9-10,13-14H,5-8H2,1-4H3,(H,21,22) IXUWMPJPOBEFGZ-UHFFFAOYSA-N 249298 US10017501, Compound 1020-120::US9458145, 1020-120 Bromodomain-containing protein 4 [75-147] Human 88.5 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249298 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249298&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86280936 346543799 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434927 Cc1noc(C)c1-c1cc(C(O)C2CCCC2)c2nc([nH]c2c1)C1CC1 249299 US10017501, Compound 1020-121::US9458145, 1020-121 Bromodomain-containing protein 4 [75-147] Human 95.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249299 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249299&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86280938 346543800 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434928 CCC(O)(CC)c1cc(cc2n(C)c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C21H27N3O2/c1-6-21(25,7-2)16-10-15(18-12(3)23-26-13(18)4)11-17-19(16)22-20(24(17)5)14-8-9-14/h10-11,14,25H,6-9H2,1-5H3 PMOURSVBCSMDLV-UHFFFAOYSA-N 249300 US10017501, Compound 1020-132::US9458145, 1020-132 Bromodomain-containing protein 4 [75-147] Human 609.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249300 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249300&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281211 346543801 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434929 CC1CCC(=O)N1c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C 249301 US10017501, Compound 1020-136::US9458145, 1020-136 Bromodomain-containing protein 4 [75-147] Human 823.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249301 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249301&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281740 346543802 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434930 CCC1CCC(=O)N1c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C 249302 US10017501, Compound 1020-137::US9458145, 1020-137 Bromodomain-containing protein 4 [75-147] Human 186.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249302 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249302&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281872 346543803 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434931 Cc1noc(C)c1-c1cc(c2nc(Cc3ccccc3)[nH]c2c1)S(=O)(=O)NC1CCCC1 InChI=1S/C24H26N4O3S/c1-15-23(16(2)31-27-15)18-13-20-24(26-22(25-20)12-17-8-4-3-5-9-17)21(14-18)32(29,30)28-19-10-6-7-11-19/h3-5,8-9,13-14,19,28H,6-7,10-12H2,1-2H3,(H,25,26) ZYCCKDGGNIOHLV-UHFFFAOYSA-N 249303 US10017501, Compound 1020-141::US9458145, 1020-141 Bromodomain-containing protein 4 [75-147] Human 704.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249303 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249303&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282559 346543804 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434932 Cc1noc(C)c1-c1cc(c2nc(NCC(F)(F)F)[nH]c2c1)S(=O)(=O)NC1CCCC1 InChI=1S/C19H22F3N5O3S/c1-10-16(11(2)30-26-10)12-7-14-17(25-18(24-14)23-9-19(20,21)22)15(8-12)31(28,29)27-13-5-3-4-6-13/h7-8,13,27H,3-6,9H2,1-2H3,(H2,23,24,25) HDARKJYJRLDMQA-UHFFFAOYSA-N 249304 US10017501, Compound 1020-148::US9458145, 1020-148 Bromodomain-containing protein 4 [75-147] Human 185.618 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249304 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249304&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282834 346543805 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434933 Cc1noc(C)c1-c1cc(c2nc(NCC3CC3)[nH]c2c1)S(=O)(=O)NC1CCCC1 InChI=1S/C21H27N5O3S/c1-12-19(13(2)29-25-12)15-9-17-20(24-21(23-17)22-11-14-7-8-14)18(10-15)30(27,28)26-16-5-3-4-6-16/h9-10,14,16,26H,3-8,11H2,1-2H3,(H2,22,23,24) MEUUQDCOTOKHAT-UHFFFAOYSA-N 249273 US10017501, Compound 1020-1::US9458145, 1020-1 Bromodomain-containing protein 4 [368-440] Human 97.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249273 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249273&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282694 346543774 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434934 CSc1nc2c(cc(cc2[nH]1)-c1c(C)noc1C)S(=O)(=O)NC1CCCC1 InChI=1S/C18H22N4O3S2/c1-10-16(11(2)25-21-10)12-8-14-17(20-18(19-14)26-3)15(9-12)27(23,24)22-13-6-4-5-7-13/h8-9,13,22H,4-7H2,1-3H3,(H,19,20) LWWBJYKHKNDJHR-UHFFFAOYSA-N 249274 US10017501, Compound 1020-4::US9458145, 1020-4 Bromodomain-containing protein 4 [368-440] Human 229.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249274 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249274&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282835 346543775 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434935 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)S(C)=O)S(=O)(=O)NC1CCCC1 249275 US10017501, Compound 1020-5::US9458145, 1020-5 Bromodomain-containing protein 4 [368-440] Human 357.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249275 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249275&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282836 346543776 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434936 Cc1cnn(C)c1-c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C InChI=1S/C20H21N5O/c1-10-9-21-25(4)19(10)15-7-14(17-11(2)24-26-12(17)3)8-16-18(15)23-20(22-16)13-5-6-13/h7-9,13H,5-6H2,1-4H3,(H,22,23) NAHZVDUSKYOCRO-UHFFFAOYSA-N 249276 US10017501, Compound 1020-12::US9458145, 1020-12 Bromodomain-containing protein 4 [368-440] Human 69.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249276 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249276&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689344 346543777 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434937 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2[nH]c(nc2c1)C1CC1 InChI=1S/C25H22N4O/c1-13-6-9-20-18(5-4-10-26-20)22(13)19-11-17(23-14(2)29-30-15(23)3)12-21-24(19)28-25(27-21)16-7-8-16/h4-6,9-12,16H,7-8H2,1-3H3,(H,27,28) KHQQNXFBTALTQF-UHFFFAOYSA-N 249277 US10017501, Compound 1020-18::US9458145, 1020-18 Bromodomain-containing protein 4 [368-440] Human 78.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249277 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249277&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86301666 346543778 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434938 Cc1noc(C)c1-c1cc(-c2cccnc2-c2ccccc2)c2nc([nH]c2c1)C1CC1 InChI=1S/C26H22N4O/c1-15-23(16(2)31-30-15)19-13-21(25-22(14-19)28-26(29-25)18-10-11-18)20-9-6-12-27-24(20)17-7-4-3-5-8-17/h3-9,12-14,18H,10-11H2,1-2H3,(H,28,29) ZTTDZAWIKNDGPB-UHFFFAOYSA-N 249278 US10017501, Compound 1020-19::US9458145, 1020-19 Bromodomain-containing protein 4 [368-440] Human 171.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249278 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249278&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282285 346543779 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434939 CC\C=C(/CC)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C InChI=1S/C21H25N3O/c1-5-7-14(6-2)17-10-16(19-12(3)24-25-13(19)4)11-18-20(17)23-21(22-18)15-8-9-15/h7,10-11,15H,5-6,8-9H2,1-4H3,(H,22,23)/b14-7+ FIDCRXXEFWLWFD-VGOFMYFVSA-N 249279 US10017501, Compound 1020-28::US9458145, 1020-28 Bromodomain-containing protein 4 [368-440] Human 65.5 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249279 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249279&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86280791 346543780 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434940 Cc1noc(C)c1-c1cc(\C=C\c2ccccc2)c2[nH]c(nc2c1)C1CC1 InChI=1S/C23H21N3O/c1-14-21(15(2)27-26-14)19-12-18(9-8-16-6-4-3-5-7-16)22-20(13-19)24-23(25-22)17-10-11-17/h3-9,12-13,17H,10-11H2,1-2H3,(H,24,25)/b9-8+ ZHEKNGPBYHOWGN-CMDGGOBGSA-N 249280 US10017501, Compound 1020-37::US9458145, 1020-37 Bromodomain-containing protein 4 [368-440] Human 2509.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249280 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249280&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281607 346543781 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434941 CC(c1ccc(F)cc1)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C 249281 US10017501, Compound 1020-44::US9458145, 1020-44 Bromodomain-containing protein 4 [368-440] Human 110.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249281 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249281&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281737 346543782 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434942 Cc1noc(C)c1-c1cc(NC2CCCC2)c2nc([nH]c2c1)C1CC1 InChI=1S/C20H24N4O/c1-11-18(12(2)25-24-11)14-9-16(21-15-5-3-4-6-15)19-17(10-14)22-20(23-19)13-7-8-13/h9-10,13,15,21H,3-8H2,1-2H3,(H,22,23) UFMRZYYXPWVWNN-UHFFFAOYSA-N 249282 US10017501, Compound 1020-50::US9458145, 1020-50 Bromodomain-containing protein 4 [368-440] Human 317.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249282 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249282&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689239 346543783 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434943 Cc1noc(C)c1-c1cc(-c2c(C)ccnc2C)c2[nH]c(nc2c1)C1CC1 InChI=1S/C22H22N4O/c1-11-7-8-23-12(2)19(11)17-9-16(20-13(3)26-27-14(20)4)10-18-21(17)25-22(24-18)15-5-6-15/h7-10,15H,5-6H2,1-4H3,(H,24,25) PMNSTIGCGOIMNI-UHFFFAOYSA-N 249283 US10017501, Compound 1020-57::US9458145, 1020-57 Bromodomain-containing protein 4 [368-440] Human 54.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249283 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249283&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689290 346543784 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434944 Cc1n[nH]c(C)c1-c1cc(cc2nc(C3CC3)n(C)c12)-c1c(C)noc1C InChI=1S/C21H23N5O/c1-10-18(11(2)24-23-10)16-8-15(19-12(3)25-27-13(19)4)9-17-20(16)26(5)21(22-17)14-6-7-14/h8-9,14H,6-7H2,1-5H3,(H,23,24) QNBJGCLVDFUBMZ-UHFFFAOYSA-N 249284 US10017501, Compound 1020-72::US9458145, 1020-72 Bromodomain-containing protein 4 [368-440] Human 69.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249284 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249284&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689582 346543785 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434945 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2n(C)c(nc2c1)C1CC1 InChI=1S/C26H24N4O/c1-14-7-10-21-19(6-5-11-27-21)23(14)20-12-18(24-15(2)29-31-16(24)3)13-22-25(20)30(4)26(28-22)17-8-9-17/h5-7,10-13,17H,8-9H2,1-4H3 MDMMPXBYWBPZAT-UHFFFAOYSA-N 249285 US10017501, Compound 1020-74::US9458145, 1020-74 Bromodomain-containing protein 4 [368-440] Human 111.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249285 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249285&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282419 346543786 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434946 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C20H21N5O/c1-9-17(10(2)24-23-9)15-7-14(18-11(3)25-26-12(18)4)8-16-19(15)22-20(21-16)13-5-6-13/h7-8,13H,5-6H2,1-4H3,(H,21,22)(H,23,24) UVADONZESFBOCU-UHFFFAOYSA-N 249286 US9458145, 1020-75 Bromodomain-containing protein 4 [368-440] Human 78.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249286 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249286&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689434 346543787 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434947 Cc1nc2cc(cc(-c3c(C)n[nH]c3C)c2[nH]1)-c1c(C)noc1C InChI=1S/C18H19N5O/c1-8-16(9(2)22-21-8)14-6-13(17-10(3)23-24-11(17)4)7-15-18(14)20-12(5)19-15/h6-7H,1-5H3,(H,19,20)(H,21,22) VOTGXBKUYUWTOH-UHFFFAOYSA-N 249287 US10017501, Compound 1020-77::US9458145, 1020-77 Bromodomain-containing protein 4 [368-440] Human 64.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249287 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249287&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689723 346543788 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434948 Cc1n[nH]c(C)c1-c1cc(cc2nc([nH]c12)C1CC1(F)F)-c1c(C)noc1C InChI=1S/C20H17F2N5O/c1-8-16(9(2)26-25-8)13-5-12(17-10(3)27-28-11(17)4)6-15-18(13)24-19(23-15)14-7-20(14,21)22/h5-6,14H,7H2,1-4H3 RMCZCJRPBQPLJA-UHFFFAOYSA-N 249288 US10017501, Compound 1020-78::US9458145, 1020-78 Bromodomain-containing protein 4 [368-440] Human 94.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249288 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249288&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689237 346543789 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434949 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(NCC3CC3)nc12)-c1c(C)noc1C InChI=1S/C21H24N6O/c1-10-18(11(2)26-25-10)16-7-15(19-12(3)27-28-13(19)4)8-17-20(16)24-21(23-17)22-9-14-5-6-14/h7-8,14H,5-6,9H2,1-4H3,(H,25,26)(H2,22,23,24) CBKDXQMZHYYTEI-UHFFFAOYSA-N 249289 US10017501, Compound 1020-79::US9458145, 1020-79 Bromodomain-containing protein 4 [368-440] Human 87.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249289 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249289&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689315 346543790 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434950 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(NC3CC3)nc12)-c1c(C)noc1C InChI=1S/C20H22N6O/c1-9-17(10(2)25-24-9)15-7-13(18-11(3)26-27-12(18)4)8-16-19(15)23-20(22-16)21-14-5-6-14/h7-8,14H,5-6H2,1-4H3,(H,24,25)(H2,21,22,23) CPQRZDPSADFJEU-UHFFFAOYSA-N 249290 US10017501, Compound 1020-81::US9458145, 1020-81 Bromodomain-containing protein 4 [368-440] Human 118.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249290 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249290&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689658 346543791 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434951 Cc1noc(C)c1-c1cc(-c2c(C)ccnc2C)c2nc[nH]c2c1 InChI=1S/C19H18N4O/c1-10-5-6-20-11(2)17(10)15-7-14(8-16-19(15)22-9-21-16)18-12(3)23-24-13(18)4/h5-9H,1-4H3,(H,21,22) PNNSPWUDQDPRGS-UHFFFAOYSA-N 249291 US10017501, Compound 1020-84::US9458145, 1020-84 Bromodomain-containing protein 4 [368-440] Human 234.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249291 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249291&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282420 346543792 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434952 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)-c1cnn(C)c1 InChI=1S/C26H22N6O/c1-14-7-8-21-19(6-5-9-27-21)23(14)20-10-17(24-15(2)31-33-16(24)3)11-22-25(20)30-26(29-22)18-12-28-32(4)13-18/h5-13H,1-4H3,(H,29,30) VKCISKKMCAGVPR-UHFFFAOYSA-N 249292 US10017501, Compound 1020-88::US9458145, 1020-88 Bromodomain-containing protein 4 [368-440] Human 131.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249292 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249292&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282555 346543793 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434953 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)C(O)CCO 249293 US10017501, Compound 1020-89::US9458145, 1020-89 Bromodomain-containing protein 4 [368-440] Human 151.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249293 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249293&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689407 346543794 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434954 COc1nc2c(cc(cc2[nH]1)-c1c(C)noc1C)-c1c(C)ccc2ncccc12 InChI=1S/C23H20N4O2/c1-12-7-8-18-16(6-5-9-24-18)20(12)17-10-15(21-13(2)27-29-14(21)3)11-19-22(17)26-23(25-19)28-4/h5-11H,1-4H3,(H,25,26) ZHSYNUAULROSRV-UHFFFAOYSA-N 249294 US10017501, Compound 1020-90::US9458145, 1020-90 Bromodomain-containing protein 4 [368-440] Human 121.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249294 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249294&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689440 346543795 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434955 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)C(F)(F)F InChI=1S/C23H17F3N4O/c1-11-6-7-17-15(5-4-8-27-17)19(11)16-9-14(20-12(2)30-31-13(20)3)10-18-21(16)29-22(28-18)23(24,25)26/h4-10H,1-3H3,(H,28,29) XSOQPGCEEYGUOO-UHFFFAOYSA-N 249295 US10017501, Compound 1020-92::US9458145, 1020-92 Bromodomain-containing protein 4 [368-440] Human 102.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249295 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249295&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282422 346543796 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434956 Cc1n[nH]c(C)c1-c1cc(cc2nc(N)[nH]c12)-c1c(C)noc1C InChI=1S/C17H18N6O/c1-7-14(8(2)22-21-7)12-5-11(15-9(3)23-24-10(15)4)6-13-16(12)20-17(18)19-13/h5-6H,1-4H3,(H,21,22)(H3,18,19,20) PUWUOAONKKOSFC-UHFFFAOYSA-N 249296 US10017501, Compound 1020-96::US9458145, 1020-96 Bromodomain-containing protein 4 [368-440] Human 96.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249296 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249296&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689303 346543797 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434957 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1ccccc1 InChI=1S/C28H25N3O2/c1-17-25(18(2)33-31-17)20-15-23(26-24(16-20)29-27(30-26)19-13-14-19)28(32,21-9-5-3-6-10-21)22-11-7-4-8-12-22/h3-12,15-16,19,32H,13-14H2,1-2H3,(H,29,30) VCOPOFJUYXUWQK-UHFFFAOYSA-N 249297 US10017501, Compound 1020-102::US9458145, 1020-102 Bromodomain-containing protein 4 [368-440] Human 75.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249297 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249297&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281080 346543798 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434958 CCC(CC)c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C20H25N3O/c1-5-13(6-2)16-9-15(18-11(3)23-24-12(18)4)10-17-19(16)22-20(21-17)14-7-8-14/h9-10,13-14H,5-8H2,1-4H3,(H,21,22) IXUWMPJPOBEFGZ-UHFFFAOYSA-N 249298 US10017501, Compound 1020-120::US9458145, 1020-120 Bromodomain-containing protein 4 [368-440] Human 76.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249298 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249298&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86280936 346543799 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434959 Cc1noc(C)c1-c1cc(C(O)C2CCCC2)c2nc([nH]c2c1)C1CC1 249299 US10017501, Compound 1020-121::US9458145, 1020-121 Bromodomain-containing protein 4 [368-440] Human 80.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249299 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249299&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86280938 346543800 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434960 CCC(O)(CC)c1cc(cc2n(C)c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C21H27N3O2/c1-6-21(25,7-2)16-10-15(18-12(3)23-26-13(18)4)11-17-19(16)22-20(24(17)5)14-8-9-14/h10-11,14,25H,6-9H2,1-5H3 PMOURSVBCSMDLV-UHFFFAOYSA-N 249300 US10017501, Compound 1020-132::US9458145, 1020-132 Bromodomain-containing protein 4 [368-440] Human 882.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249300 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249300&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281211 346543801 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434961 CC1CCC(=O)N1c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C 249301 US10017501, Compound 1020-136::US9458145, 1020-136 Bromodomain-containing protein 4 [368-440] Human 727.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249301 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249301&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281740 346543802 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434962 CCC1CCC(=O)N1c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C 249302 US10017501, Compound 1020-137::US9458145, 1020-137 Bromodomain-containing protein 4 [368-440] Human 399.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249302 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249302&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281872 346543803 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434963 Cc1noc(C)c1-c1cc(c2nc(Cc3ccccc3)[nH]c2c1)S(=O)(=O)NC1CCCC1 InChI=1S/C24H26N4O3S/c1-15-23(16(2)31-27-15)18-13-20-24(26-22(25-20)12-17-8-4-3-5-9-17)21(14-18)32(29,30)28-19-10-6-7-11-19/h3-5,8-9,13-14,19,28H,6-7,10-12H2,1-2H3,(H,25,26) ZYCCKDGGNIOHLV-UHFFFAOYSA-N 249303 US10017501, Compound 1020-141::US9458145, 1020-141 Bromodomain-containing protein 4 [368-440] Human 111.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249303 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249303&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282559 346543804 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434964 Cc1noc(C)c1-c1cc(c2nc(NCC(F)(F)F)[nH]c2c1)S(=O)(=O)NC1CCCC1 InChI=1S/C19H22F3N5O3S/c1-10-16(11(2)30-26-10)12-7-14-17(25-18(24-14)23-9-19(20,21)22)15(8-12)31(28,29)27-13-5-3-4-6-13/h7-8,13,27H,3-6,9H2,1-2H3,(H2,23,24,25) HDARKJYJRLDMQA-UHFFFAOYSA-N 249304 US10017501, Compound 1020-148::US9458145, 1020-148 Bromodomain-containing protein 4 [368-440] Human 180.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803461 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249304 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249304&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86282834 346543805 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434965 Cc1cnn(C)c1-c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C InChI=1S/C20H21N5O/c1-10-9-21-25(4)19(10)15-7-14(17-11(2)24-26-12(17)3)8-16-18(15)23-20(22-16)13-5-6-13/h7-9,13H,5-6H2,1-4H3,(H,22,23) NAHZVDUSKYOCRO-UHFFFAOYSA-N 249276 US10017501, Compound 1020-12::US9458145, 1020-12 Bromodomain-containing protein 4 [75-147] Human 46.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249276 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249276&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689344 346543777 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434966 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2[nH]c(nc2c1)C1CC1 InChI=1S/C25H22N4O/c1-13-6-9-20-18(5-4-10-26-20)22(13)19-11-17(23-14(2)29-30-15(23)3)12-21-24(19)28-25(27-21)16-7-8-16/h4-6,9-12,16H,7-8H2,1-3H3,(H,27,28) KHQQNXFBTALTQF-UHFFFAOYSA-N 249277 US10017501, Compound 1020-18::US9458145, 1020-18 Bromodomain-containing protein 4 [75-147] Human 14.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249277 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249277&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86301666 346543778 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434967 Cc1noc(C)c1-c1cc(-c2cccnc2-c2ccccc2)c2nc([nH]c2c1)C1CC1 InChI=1S/C26H22N4O/c1-15-23(16(2)31-30-15)19-13-21(25-22(14-19)28-26(29-25)18-10-11-18)20-9-6-12-27-24(20)17-7-4-3-5-8-17/h3-9,12-14,18H,10-11H2,1-2H3,(H,28,29) ZTTDZAWIKNDGPB-UHFFFAOYSA-N 249278 US10017501, Compound 1020-19::US9458145, 1020-19 Bromodomain-containing protein 4 [75-147] Human 28.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249278 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249278&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282285 346543779 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434968 CC\C=C(/CC)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C InChI=1S/C21H25N3O/c1-5-7-14(6-2)17-10-16(19-12(3)24-25-13(19)4)11-18-20(17)23-21(22-18)15-8-9-15/h7,10-11,15H,5-6,8-9H2,1-4H3,(H,22,23)/b14-7+ FIDCRXXEFWLWFD-VGOFMYFVSA-N 249279 US10017501, Compound 1020-28::US9458145, 1020-28 Bromodomain-containing protein 4 [75-147] Human 18.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249279 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249279&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86280791 346543780 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434969 Cc1noc(C)c1-c1cc(\C=C\c2ccccc2)c2[nH]c(nc2c1)C1CC1 InChI=1S/C23H21N3O/c1-14-21(15(2)27-26-14)19-12-18(9-8-16-6-4-3-5-7-16)22-20(13-19)24-23(25-22)17-10-11-17/h3-9,12-13,17H,10-11H2,1-2H3,(H,24,25)/b9-8+ ZHEKNGPBYHOWGN-CMDGGOBGSA-N 249280 US10017501, Compound 1020-37::US9458145, 1020-37 Bromodomain-containing protein 4 [75-147] Human 3170.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249280 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249280&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281607 346543781 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434970 CC(c1ccc(F)cc1)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C 249281 US10017501, Compound 1020-44::US9458145, 1020-44 Bromodomain-containing protein 4 [75-147] Human 22.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249281 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249281&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281737 346543782 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434971 Cc1noc(C)c1-c1cc(NC2CCCC2)c2nc([nH]c2c1)C1CC1 InChI=1S/C20H24N4O/c1-11-18(12(2)25-24-11)14-9-16(21-15-5-3-4-6-15)19-17(10-14)22-20(23-19)13-7-8-13/h9-10,13,15,21H,3-8H2,1-2H3,(H,22,23) UFMRZYYXPWVWNN-UHFFFAOYSA-N 249282 US10017501, Compound 1020-50::US9458145, 1020-50 Bromodomain-containing protein 4 [75-147] Human 125.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249282 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249282&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689239 346543783 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434972 Cc1noc(C)c1-c1cc(-c2c(C)ccnc2C)c2[nH]c(nc2c1)C1CC1 InChI=1S/C22H22N4O/c1-11-7-8-23-12(2)19(11)17-9-16(20-13(3)26-27-14(20)4)10-18-21(17)25-22(24-18)15-5-6-15/h7-10,15H,5-6H2,1-4H3,(H,24,25) PMNSTIGCGOIMNI-UHFFFAOYSA-N 249283 US10017501, Compound 1020-57::US9458145, 1020-57 Bromodomain-containing protein 4 [75-147] Human 22.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249283 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249283&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689290 346543784 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434973 Cc1n[nH]c(C)c1-c1cc(cc2nc(C3CC3)n(C)c12)-c1c(C)noc1C InChI=1S/C21H23N5O/c1-10-18(11(2)24-23-10)16-8-15(19-12(3)25-27-13(19)4)9-17-20(16)26(5)21(22-17)14-6-7-14/h8-9,14H,6-7H2,1-5H3,(H,23,24) QNBJGCLVDFUBMZ-UHFFFAOYSA-N 249284 US10017501, Compound 1020-72::US9458145, 1020-72 Bromodomain-containing protein 4 [75-147] Human 12.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249284 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249284&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689582 346543785 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434974 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2n(C)c(nc2c1)C1CC1 InChI=1S/C26H24N4O/c1-14-7-10-21-19(6-5-11-27-21)23(14)20-12-18(24-15(2)29-31-16(24)3)13-22-25(20)30(4)26(28-22)17-8-9-17/h5-7,10-13,17H,8-9H2,1-4H3 MDMMPXBYWBPZAT-UHFFFAOYSA-N 249285 US10017501, Compound 1020-74::US9458145, 1020-74 Bromodomain-containing protein 4 [75-147] Human 18.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249285 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249285&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282419 346543786 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434975 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C20H21N5O/c1-9-17(10(2)24-23-9)15-7-14(18-11(3)25-26-12(18)4)8-16-19(15)22-20(21-16)13-5-6-13/h7-8,13H,5-6H2,1-4H3,(H,21,22)(H,23,24) UVADONZESFBOCU-UHFFFAOYSA-N 249286 US9458145, 1020-75 Bromodomain-containing protein 4 [75-147] Human 33.5 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249286 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249286&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689434 346543787 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434976 Cc1nc2cc(cc(-c3c(C)n[nH]c3C)c2[nH]1)-c1c(C)noc1C InChI=1S/C18H19N5O/c1-8-16(9(2)22-21-8)14-6-13(17-10(3)23-24-11(17)4)7-15-18(14)20-12(5)19-15/h6-7H,1-5H3,(H,19,20)(H,21,22) VOTGXBKUYUWTOH-UHFFFAOYSA-N 249287 US10017501, Compound 1020-77::US9458145, 1020-77 Bromodomain-containing protein 4 [75-147] Human 42.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249287 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249287&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689723 346543788 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434977 Cc1n[nH]c(C)c1-c1cc(cc2nc([nH]c12)C1CC1(F)F)-c1c(C)noc1C InChI=1S/C20H17F2N5O/c1-8-16(9(2)26-25-8)13-5-12(17-10(3)27-28-11(17)4)6-15-18(13)24-19(23-15)14-7-20(14,21)22/h5-6,14H,7H2,1-4H3 RMCZCJRPBQPLJA-UHFFFAOYSA-N 249288 US10017501, Compound 1020-78::US9458145, 1020-78 Bromodomain-containing protein 4 [75-147] Human 25.1 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249288 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249288&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689237 346543789 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434978 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(NCC3CC3)nc12)-c1c(C)noc1C InChI=1S/C21H24N6O/c1-10-18(11(2)26-25-10)16-7-15(19-12(3)27-28-13(19)4)8-17-20(16)24-21(23-17)22-9-14-5-6-14/h7-8,14H,5-6,9H2,1-4H3,(H,25,26)(H2,22,23,24) CBKDXQMZHYYTEI-UHFFFAOYSA-N 249289 US10017501, Compound 1020-79::US9458145, 1020-79 Bromodomain-containing protein 4 [75-147] Human 33.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249289 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249289&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689315 346543790 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434979 Cc1n[nH]c(C)c1-c1cc(cc2[nH]c(NC3CC3)nc12)-c1c(C)noc1C InChI=1S/C20H22N6O/c1-9-17(10(2)25-24-9)15-7-13(18-11(3)26-27-12(18)4)8-16-19(15)23-20(22-16)21-14-5-6-14/h7-8,14H,5-6H2,1-4H3,(H,24,25)(H2,21,22,23) CPQRZDPSADFJEU-UHFFFAOYSA-N 249290 US10017501, Compound 1020-81::US9458145, 1020-81 Bromodomain-containing protein 4 [75-147] Human 50.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249290 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249290&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689658 346543791 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434980 Cc1noc(C)c1-c1cc(-c2c(C)ccnc2C)c2nc[nH]c2c1 InChI=1S/C19H18N4O/c1-10-5-6-20-11(2)17(10)15-7-14(8-16-19(15)22-9-21-16)18-12(3)23-24-13(18)4/h5-9H,1-4H3,(H,21,22) PNNSPWUDQDPRGS-UHFFFAOYSA-N 249291 US10017501, Compound 1020-84::US9458145, 1020-84 Bromodomain-containing protein 4 [75-147] Human 277.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249291 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249291&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282420 346543792 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434981 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)-c1cnn(C)c1 InChI=1S/C26H22N6O/c1-14-7-8-21-19(6-5-9-27-21)23(14)20-10-17(24-15(2)31-33-16(24)3)11-22-25(20)30-26(29-22)18-12-28-32(4)13-18/h5-13H,1-4H3,(H,29,30) VKCISKKMCAGVPR-UHFFFAOYSA-N 249292 US10017501, Compound 1020-88::US9458145, 1020-88 Bromodomain-containing protein 4 [75-147] Human 15.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249292 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249292&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282555 346543793 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434982 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)C(O)CCO 249293 US10017501, Compound 1020-89::US9458145, 1020-89 Bromodomain-containing protein 4 [75-147] Human 130.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249293 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249293&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689407 346543794 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434983 COc1nc2c(cc(cc2[nH]1)-c1c(C)noc1C)-c1c(C)ccc2ncccc12 InChI=1S/C23H20N4O2/c1-12-7-8-18-16(6-5-9-24-18)20(12)17-10-15(21-13(2)27-29-14(21)3)11-19-22(17)26-23(25-19)28-4/h5-11H,1-4H3,(H,25,26) ZHSYNUAULROSRV-UHFFFAOYSA-N 249294 US10017501, Compound 1020-90::US9458145, 1020-90 Bromodomain-containing protein 4 [75-147] Human 29.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249294 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249294&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689440 346543795 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434984 Cc1noc(C)c1-c1cc(-c2c(C)ccc3ncccc23)c2nc([nH]c2c1)C(F)(F)F InChI=1S/C23H17F3N4O/c1-11-6-7-17-15(5-4-8-27-17)19(11)16-9-14(20-12(2)30-31-13(20)3)10-18-21(16)29-22(28-18)23(24,25)26/h4-10H,1-3H3,(H,28,29) XSOQPGCEEYGUOO-UHFFFAOYSA-N 249295 US10017501, Compound 1020-92::US9458145, 1020-92 Bromodomain-containing protein 4 [75-147] Human 37.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249295 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249295&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86282422 346543796 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434985 Cc1n[nH]c(C)c1-c1cc(cc2nc(N)[nH]c12)-c1c(C)noc1C InChI=1S/C17H18N6O/c1-7-14(8(2)22-21-7)12-5-11(15-9(3)23-24-10(15)4)6-13-16(12)20-17(18)19-13/h5-6H,1-4H3,(H,21,22)(H3,18,19,20) PUWUOAONKKOSFC-UHFFFAOYSA-N 249296 US10017501, Compound 1020-96::US9458145, 1020-96 Bromodomain-containing protein 4 [75-147] Human 53.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249296 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249296&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689303 346543797 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434986 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1ccccc1 InChI=1S/C28H25N3O2/c1-17-25(18(2)33-31-17)20-15-23(26-24(16-20)29-27(30-26)19-13-14-19)28(32,21-9-5-3-6-10-21)22-11-7-4-8-12-22/h3-12,15-16,19,32H,13-14H2,1-2H3,(H,29,30) VCOPOFJUYXUWQK-UHFFFAOYSA-N 249297 US10017501, Compound 1020-102::US9458145, 1020-102 Bromodomain-containing protein 4 [75-147] Human 14.3 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249297 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249297&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281080 346543798 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434987 CCC(CC)c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C20H25N3O/c1-5-13(6-2)16-9-15(18-11(3)23-24-12(18)4)10-17-19(16)22-20(21-17)14-7-8-14/h9-10,13-14H,5-8H2,1-4H3,(H,21,22) IXUWMPJPOBEFGZ-UHFFFAOYSA-N 249298 US10017501, Compound 1020-120::US9458145, 1020-120 Bromodomain-containing protein 4 [75-147] Human 39.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249298 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249298&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86280936 346543799 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434988 Cc1noc(C)c1-c1cc(C(O)C2CCCC2)c2nc([nH]c2c1)C1CC1 249299 US10017501, Compound 1020-121::US9458145, 1020-121 Bromodomain-containing protein 4 [75-147] Human 24.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249299 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249299&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86280938 346543800 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434989 CCC(O)(CC)c1cc(cc2n(C)c(nc12)C1CC1)-c1c(C)noc1C InChI=1S/C21H27N3O2/c1-6-21(25,7-2)16-10-15(18-12(3)23-26-13(18)4)11-17-19(16)22-20(24(17)5)14-8-9-14/h10-11,14,25H,6-9H2,1-5H3 PMOURSVBCSMDLV-UHFFFAOYSA-N 249300 US10017501, Compound 1020-132::US9458145, 1020-132 Bromodomain-containing protein 4 [75-147] Human 572.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249300 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249300&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281211 346543801 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434990 CC1CCC(=O)N1c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C 249301 US10017501, Compound 1020-136::US9458145, 1020-136 Bromodomain-containing protein 4 [75-147] Human 512.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249301 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249301&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281740 346543802 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434991 CCC1CCC(=O)N1c1cc(cc2[nH]c(nc12)C1CC1)-c1c(C)noc1C 249302 US10017501, Compound 1020-137::US9458145, 1020-137 Bromodomain-containing protein 4 [75-147] Human 52.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803462 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249302 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249302&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281872 346543803 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434992 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1nccs1)c1nccs1 InChI=1S/C22H19N5O2S2/c1-11-17(12(2)29-27-11)14-9-15(18-16(10-14)25-19(26-18)13-3-4-13)22(28,20-23-5-7-30-20)21-24-6-8-31-21/h5-10,13,28H,3-4H2,1-2H3,(H,25,26) TZQMYCBSCKPPKG-UHFFFAOYSA-N 249305 US10017501, Compound 1020-103::US9458145, 1020-103 Bromodomain-containing protein 4 [75-147] Human 4.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249305 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249305&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281481 346543806 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434993 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccn1)c1ccccn1 InChI=1S/C26H23N5O2/c1-15-23(16(2)33-31-15)18-13-19(24-20(14-18)29-25(30-24)17-9-10-17)26(32,21-7-3-5-11-27-21)22-8-4-6-12-28-22/h3-8,11-14,17,32H,9-10H2,1-2H3,(H,29,30) CMSUJGUHYXQSOK-UHFFFAOYSA-N 249306 US10017501, Compound 1020-104::US9458145, 1020-104 Bromodomain-containing protein 4 [75-147] Human 7.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249306 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249306&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281210 346543807 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434994 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1cccnc1 249307 US10017501, Compound 1020-112::US9458145, 1020-112 Bromodomain-containing protein 4 [75-147] Human 10.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249307 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249307&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281212 346543808 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434995 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1ccccn1 249308 US10017501, Compound 1020-113::US9458145, 1020-113 Bromodomain-containing protein 4 [75-147] Human 10.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249308 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249308&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281214 346543809 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434996 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCCO1)c1cccc(C)n1 249309 US10017501, Compound 1020-114::US9458145, 1020-114 Bromodomain-containing protein 4 [75-147] Human 3.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249309 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249309&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281482 346543810 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434997 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1F)C1CC1)C(O)(c1ccccn1)c1ccccn1 InChI=1S/C26H22FN5O2/c1-14-21(15(2)34-32-14)17-13-18(23-24(22(17)27)31-25(30-23)16-9-10-16)26(33,19-7-3-5-11-28-19)20-8-4-6-12-29-20/h3-8,11-13,16,33H,9-10H2,1-2H3,(H,30,31) QRMLXMNLPJVQQA-UHFFFAOYSA-N 249310 US10017501, Compound 1020-224::US9458145, 1020-224 Bromodomain-containing protein 4 [75-147] Human 10.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249310 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249310&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689607 346543811 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434998 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccn1)c1ncccn1 249311 US10017501, Compound 1020-239::US9458145, 1020-239 Bromodomain-containing protein 4 [75-147] Human 5.9 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249311 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249311&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281349 346543812 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 434999 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ncccn1)c1ccc(F)cc1F 249312 US10017501, Compound 1020-257::US9458145, 1020-257 Bromodomain-containing protein 4 [75-147] Human 4.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249312 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249312&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689402 346543813 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435000 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCCO1)c1cccnn1 249313 US9458145, 1020-289 Bromodomain-containing protein 4 [75-147] Human 2.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249313 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249313&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 86281483 346543814 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435001 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCC(C)(C)O1)c1cccnn1 249314 US10017501, Compound 1020-298::US9458145, 1020-298 Bromodomain-containing protein 4 [75-147] Human 5.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249314 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=383&target=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249314&enzyme=Bromodomain-containing+protein+4+%5B75-147%5D&column=ki&startPg=0&Increment=50&submit=Search 117689281 346543815 1 WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435002 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1nccs1)c1nccs1 InChI=1S/C22H19N5O2S2/c1-11-17(12(2)29-27-11)14-9-15(18-16(10-14)25-19(26-18)13-3-4-13)22(28,20-23-5-7-30-20)21-24-6-8-31-21/h5-10,13,28H,3-4H2,1-2H3,(H,25,26) TZQMYCBSCKPPKG-UHFFFAOYSA-N 249305 US10017501, Compound 1020-103::US9458145, 1020-103 Bromodomain-containing protein 4 [368-440] Human 12.4 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249305 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249305&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281481 346543806 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435003 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccn1)c1ccccn1 InChI=1S/C26H23N5O2/c1-15-23(16(2)33-31-15)18-13-19(24-20(14-18)29-25(30-24)17-9-10-17)26(32,21-7-3-5-11-27-21)22-8-4-6-12-28-22/h3-8,11-14,17,32H,9-10H2,1-2H3,(H,29,30) CMSUJGUHYXQSOK-UHFFFAOYSA-N 249306 US10017501, Compound 1020-104::US9458145, 1020-104 Bromodomain-containing protein 4 [368-440] Human 11.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249306 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249306&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281210 346543807 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435004 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1cccnc1 249307 US10017501, Compound 1020-112::US9458145, 1020-112 Bromodomain-containing protein 4 [368-440] Human 13.5 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249307 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249307&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281212 346543808 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435005 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccc1)c1ccccn1 249308 US10017501, Compound 1020-113::US9458145, 1020-113 Bromodomain-containing protein 4 [368-440] Human 12.8 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249308 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249308&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281214 346543809 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435006 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCCO1)c1cccc(C)n1 249309 US10017501, Compound 1020-114::US9458145, 1020-114 Bromodomain-containing protein 4 [368-440] Human 2.7 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249309 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249309&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281482 346543810 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435007 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1F)C1CC1)C(O)(c1ccccn1)c1ccccn1 InChI=1S/C26H22FN5O2/c1-14-21(15(2)34-32-14)17-13-18(23-24(22(17)27)31-25(30-23)16-9-10-16)26(33,19-7-3-5-11-28-19)20-8-4-6-12-29-20/h3-8,11-13,16,33H,9-10H2,1-2H3,(H,30,31) QRMLXMNLPJVQQA-UHFFFAOYSA-N 249310 US10017501, Compound 1020-224::US9458145, 1020-224 Bromodomain-containing protein 4 [368-440] Human 20.2 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249310 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249310&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689607 346543811 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435008 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ccccn1)c1ncccn1 249311 US10017501, Compound 1020-239::US9458145, 1020-239 Bromodomain-containing protein 4 [368-440] Human 6.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249311 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249311&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281349 346543812 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435009 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(c1ncccn1)c1ccc(F)cc1F 249312 US10017501, Compound 1020-257::US9458145, 1020-257 Bromodomain-containing protein 4 [368-440] Human 5.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249312 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249312&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689402 346543813 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435010 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCCO1)c1cccnn1 249313 US9458145, 1020-289 Bromodomain-containing protein 4 [368-440] Human 2.0 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249313 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249313&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 86281483 346543814 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3 435011 Cc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCC(C)(C)O1)c1cccnn1 249314 US10017501, Compound 1020-298::US9458145, 1020-298 Bromodomain-containing protein 4 [368-440] Human 3.6 7.5 25.00 C US Patent 10.7270/Q26Q1W53 aid1803463 US9458145 Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J 10/4/2016 9/11/2017 Gilead Sciences Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=249314 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=379&target=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=249314&enzyme=Bromodomain-containing+protein+4+%5B368-440%5D&column=ki&startPg=0&Increment=50&submit=Search 117689281 346543815 1 KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVV Bromodomain-containing protein 4 BRD4_HUMAN O60885 O60433 Q4G0X8 Q86YS8 Q96PD3