BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 390189 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(Cl)c2ccccc12 InChI=1S/C25H23ClN2O4/c1-32-22-10-15(12-27-23(22)24(29)18-11-19(18)25(30)31)28(13-14-6-7-14)21-9-8-20(26)16-4-2-3-5-17(16)21/h2-5,8-10,12,14,18-19H,6-7,11,13H2,1H3,(H,30,31) GAJVRXZWMXIAIF-UHFFFAOYSA-N 223226 2-(5-((4-Chloronaphthalen-1-yl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 1::US9657001, 1 Leukotriene C4 synthase Homo sapiens 18 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223226 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223226&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670176 336285102 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390190 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C21H21ClN2O4/c1-28-18-8-15(10-23-19(18)20(25)16-9-17(16)21(26)27)24(11-12-2-3-12)14-6-4-13(22)5-7-14/h4-8,10,12,16-17H,2-3,9,11H2,1H3,(H,26,27) RGANFCZPDDPSBH-UHFFFAOYSA-N 223227 2-(5-((4-Chlorobenzyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 2::US9657001, 2 Leukotriene C4 synthase Homo sapiens 86 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223227 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223227&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670171 336285103 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390191 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(C(C1CC1)C(F)(F)F)c1ccc(Cl)cc1 InChI=1S/C22H20ClF3N2O4/c1-32-17-8-14(10-27-18(17)19(29)15-9-16(15)21(30)31)28(13-6-4-12(23)5-7-13)20(11-2-3-11)22(24,25)26/h4-8,10-11,15-16,20H,2-3,9H2,1H3,(H,30,31) LWAUMGSKFOFDCB-UHFFFAOYSA-N 223228 2-(5-((4-Chlorophenyl)((1-(trifluoromethyl)cyclopropyl)methyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 3 Leukotriene C4 synthase Homo sapiens 149 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223228 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223228&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 126961660 336285104 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390192 COCC(C1CC1)N(c1ccc(Cl)cc1)c1cnc(C(=O)C2CC2C(O)=O)c(OC)c1 InChI=1S/C23H25ClN2O5/c1-30-12-19(13-3-4-13)26(15-7-5-14(24)6-8-15)16-9-20(31-2)21(25-11-16)22(27)17-10-18(17)23(28)29/h5-9,11,13,17-19H,3-4,10,12H2,1-2H3,(H,28,29) OXOCOHAWBWDYCR-UHFFFAOYSA-N 223229 2-(5-((4-Chlorophenyl)((1-(methoxymethyl)cyclopropyl)methyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 4 Leukotriene C4 synthase Homo sapiens 263 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223229 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223229&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 126961661 336285105 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390193 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1(C)CC1)c1ccc(Cl)cc1 InChI=1S/C22H23ClN2O4/c1-22(7-8-22)12-25(14-5-3-13(23)4-6-14)15-9-18(29-2)19(24-11-15)20(26)16-10-17(16)21(27)28/h3-6,9,11,16-17H,7-8,10,12H2,1-2H3,(H,27,28) AANFOUCBNMVANI-UHFFFAOYSA-N 223230 2-(5-((4-Chlorophenyl)((1-methylcyclopropyl)methyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 5::US9657001, 5 Leukotriene C4 synthase Homo sapiens 38 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223230 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223230&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670114 336285106 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390194 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1(C)CC1)c1ccc2CCCc2c1 InChI=1S/C25H28N2O4/c1-25(8-9-25)14-27(17-7-6-15-4-3-5-16(15)10-17)18-11-21(31-2)22(26-13-18)23(28)19-12-20(19)24(29)30/h6-7,10-11,13,19-20H,3-5,8-9,12,14H2,1-2H3,(H,29,30) UZIRXZUCOKESJN-UHFFFAOYSA-N 223231 2-(5-((2,3-Dihydro-1H-inden-5-yl)((1-methylcyclopropyl)methyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 6 Leukotriene C4 synthase Homo sapiens 47 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223231 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223231&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670151 336285107 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390195 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(F)c2ccccc12 InChI=1S/C25H23FN2O4/c1-32-22-10-15(12-27-23(22)24(29)18-11-19(18)25(30)31)28(13-14-6-7-14)21-9-8-20(26)16-4-2-3-5-17(16)21/h2-5,8-10,12,14,18-19H,6-7,11,13H2,1H3,(H,30,31) WTRVUWXJDQYQJK-UHFFFAOYSA-N 223232 2-(5-((Cyclopropylmethyl)(4-fluoronaphthalen-1-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 7::US9657001, 7 Leukotriene C4 synthase Homo sapiens 18 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223232 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223232&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670060 336285108 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390196 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(C)c2ncccc12 InChI=1S/C25H25N3O4/c1-14-5-8-20(17-4-3-9-26-22(14)17)28(13-15-6-7-15)16-10-21(32-2)23(27-12-16)24(29)18-11-19(18)25(30)31/h3-5,8-10,12,15,18-19H,6-7,11,13H2,1-2H3,(H,30,31) JIVYTDGWQIESCZ-UHFFFAOYSA-N 223233 2-(5-((Cyclopropylmethyl)(8-methylquinolin-5-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 8::US9657001, 8 Leukotriene C4 synthase Homo sapiens 279 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223233 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223233&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670177 336285109 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390197 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1cccc2ccccc12 InChI=1S/C25H24N2O4/c1-31-22-11-17(13-26-23(22)24(28)19-12-20(19)25(29)30)27(14-15-9-10-15)21-8-4-6-16-5-2-3-7-18(16)21/h2-8,11,13,15,19-20H,9-10,12,14H2,1H3,(H,29,30) OFOPLMNREMYRND-UHFFFAOYSA-N 223234 2-(5-((Cyclopropylmethyl)(naphthalen-1-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 9::US9657001, 9 Leukotriene C4 synthase Homo sapiens 24 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223234 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223234&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670178 336285110 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390198 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1cccc2c(C)ccnc12 InChI=1S/C25H25N3O4/c1-14-8-9-26-22-17(14)4-3-5-20(22)28(13-15-6-7-15)16-10-21(32-2)23(27-12-16)24(29)18-11-19(18)25(30)31/h3-5,8-10,12,15,18-19H,6-7,11,13H2,1-2H3,(H,30,31) OMRSXAMKMACUON-UHFFFAOYSA-N 223235 2-(5-((Cyclopropylmethyl)(4-methylquinolin-8-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 10::US9657001, 10 Leukotriene C4 synthase Homo sapiens 445 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223235 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223235&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670125 336285111 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390199 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(C)c2ccccc12 InChI=1S/C26H26N2O4/c1-15-7-10-22(19-6-4-3-5-18(15)19)28(14-16-8-9-16)17-11-23(32-2)24(27-13-17)25(29)20-12-21(20)26(30)31/h3-7,10-11,13,16,20-21H,8-9,12,14H2,1-2H3,(H,30,31) VCLWHSBLQHAZTJ-UHFFFAOYSA-N 223236 2-(5-((Cyclopropylmethyl)(4-methylnaphthalen-1-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 11::US9657001, 11 Leukotriene C4 synthase Homo sapiens 35 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223236 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223236&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670095 336285112 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390200 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc2ccccc2c1 InChI=1S/C25H24N2O4/c1-31-22-11-19(13-26-23(22)24(28)20-12-21(20)25(29)30)27(14-15-6-7-15)18-9-8-16-4-2-3-5-17(16)10-18/h2-5,8-11,13,15,20-21H,6-7,12,14H2,1H3,(H,29,30) CLIHVYIXCIRSKQ-UHFFFAOYSA-N 223237 2-(5-((Cyclopropylmethyl)(naphthalen-2-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 12::US9657001, 12 Leukotriene C4 synthase Homo sapiens 28 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223237 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223237&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670159 336285113 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390201 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C21H21ClN2O4/c1-28-18-8-15(10-23-19(18)20(25)16-9-17(16)21(26)27)24(11-12-2-3-12)14-6-4-13(22)5-7-14/h4-8,10,12,16-17H,2-3,9,11H2,1H3,(H,26,27) RGANFCZPDDPSBH-UHFFFAOYSA-N 223227 2-(5-((4-Chlorobenzyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 2::US9657001, 2 Leukotriene C4 synthase Homo sapiens 34 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223227 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223227&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670171 336285103 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390202 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(C)cc1 InChI=1S/C23H26N2O4/c1-14-3-5-15(6-4-14)12-25(13-16-7-8-16)17-9-20(29-2)21(24-11-17)22(26)18-10-19(18)23(27)28/h3-6,9,11,16,18-19H,7-8,10,12-13H2,1-2H3,(H,27,28) KYZYXMJGUMDYPK-UHFFFAOYSA-N 223239 2-(5-((Cyclopropylmethyl)(4-methylbenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 14::US9657001, 14 Leukotriene C4 synthase Homo sapiens 22 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223239 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223239&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670119 336285114 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390203 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc(C)c1 InChI=1S/C23H26N2O4/c1-14-4-3-5-16(8-14)13-25(12-15-6-7-15)17-9-20(29-2)21(24-11-17)22(26)18-10-19(18)23(27)28/h3-5,8-9,11,15,18-19H,6-7,10,12-13H2,1-2H3,(H,27,28) LDYWTXAMEJQANG-UHFFFAOYSA-N 223240 2-(5-((Cyclopropylmethyl)(3-methylbenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 15::US9657001, 15 Leukotriene C4 synthase Homo sapiens 171 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223240 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223240&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670147 336285115 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390204 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1c(Cl)cccc1Cl InChI=1S/C22H22Cl2N2O4/c1-30-19-7-13(9-25-20(19)21(27)14-8-15(14)22(28)29)26(10-12-5-6-12)11-16-17(23)3-2-4-18(16)24/h2-4,7,9,12,14-15H,5-6,8,10-11H2,1H3,(H,28,29) UPYBVJSYGGMNGS-UHFFFAOYSA-N 223241 2-(5-((Cyclopropylmethyl)(2,6-dichlorobenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 16::US9657001, 16 Leukotriene C4 synthase Homo sapiens 800 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223241 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223241&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670093 336285116 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390205 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc2ccccc2c1 InChI=1S/C26H26N2O4/c1-32-23-11-20(13-27-24(23)25(29)21-12-22(21)26(30)31)28(14-16-6-7-16)15-17-8-9-18-4-2-3-5-19(18)10-17/h2-5,8-11,13,16,21-22H,6-7,12,14-15H2,1H3,(H,30,31) HWKBEZSTQYIRCG-UHFFFAOYSA-N 223242 2-(5-((Cyclopropylmethyl)(naphthalen-2-ylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 17::US9657001, 17 Leukotriene C4 synthase Homo sapiens 34 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223242 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223242&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670116 336285117 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390206 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc(Cl)c1 InChI=1S/C22H23ClN2O4/c1-29-19-8-16(10-24-20(19)21(26)17-9-18(17)22(27)28)25(11-13-5-6-13)12-14-3-2-4-15(23)7-14/h2-4,7-8,10,13,17-18H,5-6,9,11-12H2,1H3,(H,27,28) ZTROSXLWASFTAV-UHFFFAOYSA-N 223243 2-(5-((3-Chlorobenzyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 18::US9657001, 18 Leukotriene C4 synthase Homo sapiens 39 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223243 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223243&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670059 336285118 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390207 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(F)cc1 InChI=1S/C22H23FN2O4/c1-29-19-8-16(10-24-20(19)21(26)17-9-18(17)22(27)28)25(11-13-2-3-13)12-14-4-6-15(23)7-5-14/h4-8,10,13,17-18H,2-3,9,11-12H2,1H3,(H,27,28) YBBVMJBKNSMOJJ-UHFFFAOYSA-N 223244 2-(5-((Cyclopropylmethyl)(4-fluorobenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 19::US9657001, 19 Leukotriene C4 synthase Homo sapiens 105 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223244 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223244&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670081 336285119 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390208 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc(c1C)C(F)(F)F InChI=1S/C24H25F3N2O4/c1-13-15(4-3-5-19(13)24(25,26)27)12-29(11-14-6-7-14)16-8-20(33-2)21(28-10-16)22(30)17-9-18(17)23(31)32/h3-5,8,10,14,17-18H,6-7,9,11-12H2,1-2H3,(H,31,32) JWHZXRBKSPWAMR-UHFFFAOYSA-N 223245 2-(5-((Cyclopropylmethyl)(2-methyl-3-(trifluoromethyl)benzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 20::US9657001, 20 Leukotriene C4 synthase Homo sapiens 88 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223245 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223245&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670069 336285120 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390209 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(cc1F)C(F)(F)F InChI=1S/C23H22F4N2O4/c1-33-19-7-15(9-28-20(19)21(30)16-8-17(16)22(31)32)29(10-12-2-3-12)11-13-4-5-14(6-18(13)24)23(25,26)27/h4-7,9,12,16-17H,2-3,8,10-11H2,1H3,(H,31,32) ZMKOVURELYACKT-UHFFFAOYSA-N 223246 2-(5-((Cyclopropylmethyl)(2-fluoro-4-(trifluoromethyl)benzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 21::US9657001, 21 Leukotriene C4 synthase Homo sapiens 53 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223246 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223246&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670084 336285121 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390210 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc(c1Cl)C(F)(F)F InChI=1S/C23H22ClF3N2O4/c1-33-18-7-14(9-28-20(18)21(30)15-8-16(15)22(31)32)29(10-12-5-6-12)11-13-3-2-4-17(19(13)24)23(25,26)27/h2-4,7,9,12,15-16H,5-6,8,10-11H2,1H3,(H,31,32) WSKRCKUDSZLCSR-UHFFFAOYSA-N 223247 2-(5-((2-Chloro-3-(trifluoromethyl)benzyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 22::US9657001, 22 Leukotriene C4 synthase Homo sapiens 112 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223247 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223247&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670112 336285122 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390211 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1c(C)ccc2ccccc12 InChI=1S/C27H28N2O4/c1-16-7-10-18-5-3-4-6-20(18)23(16)15-29(14-17-8-9-17)19-11-24(33-2)25(28-13-19)26(30)21-12-22(21)27(31)32/h3-7,10-11,13,17,21-22H,8-9,12,14-15H2,1-2H3,(H,31,32) RUFFZQRRKWBZFI-UHFFFAOYSA-N 223248 2-(5-((Cyclopropylmethyl)((2-methylnaphthalen-1-yl)methyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 23::US9657001, 23 Leukotriene C4 synthase Homo sapiens 1839 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223248 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223248&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670115 336285123 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390212 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(cc1)-c1ccccc1 InChI=1S/C28H28N2O4/c1-34-25-13-22(15-29-26(25)27(31)23-14-24(23)28(32)33)30(16-18-7-8-18)17-19-9-11-21(12-10-19)20-5-3-2-4-6-20/h2-6,9-13,15,18,23-24H,7-8,14,16-17H2,1H3,(H,32,33) GFCWICYCUDNXOZ-UHFFFAOYSA-N 223249 2-(5-(([1,1′-Biphenyl]-4-ylmethyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 24::US9657001, 24 Leukotriene C4 synthase Homo sapiens 2178 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223249 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223249&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670061 336285124 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390213 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc2ccccc12 InChI=1S/C26H26N2O4/c1-32-23-11-19(13-27-24(23)25(29)21-12-22(21)26(30)31)28(14-16-9-10-16)15-18-7-4-6-17-5-2-3-8-20(17)18/h2-8,11,13,16,21-22H,9-10,12,14-15H2,1H3,(H,30,31) HXFSJNQMRIHUEG-UHFFFAOYSA-N 223250 2-(5-((Cyclopropylmethyl)(naphthalen-1-ylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 25::US9657001, 25 Leukotriene C4 synthase Homo sapiens 66 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223250 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223250&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670062 336285125 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390214 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cc(F)cc2COCOc12 InChI=1S/C24H25FN2O6/c1-31-20-6-17(8-26-21(20)22(28)18-7-19(18)24(29)30)27(9-13-2-3-13)10-14-4-16(25)5-15-11-32-12-33-23(14)15/h4-6,8,13,18-19H,2-3,7,9-12H2,1H3,(H,29,30) REIBWCCORWBRBI-UHFFFAOYSA-N 223251 2-(5-((Cyclopropylmethyl)((6-fluoro-4H-benzo[d][1,3]dioxin-8-yl)methyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 26::US9657001, 26 Leukotriene C4 synthase Homo sapiens 478 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223251 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223251&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670172 336285126 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390215 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cc(Cl)cc2OCOc12 InChI=1S/C23H23ClN2O6/c1-30-18-6-15(8-25-20(18)21(27)16-7-17(16)23(28)29)26(9-12-2-3-12)10-13-4-14(24)5-19-22(13)32-11-31-19/h4-6,8,12,16-17H,2-3,7,9-11H2,1H3,(H,28,29) YAADXJUJPZZTSD-UHFFFAOYSA-N 223252 2-(5-(((6-Chlorobenzo[d][1,3]dioxol-4-yl)methyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 27::US9657001, 27 Leukotriene C4 synthase Homo sapiens 588 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223252 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223252&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670180 336285127 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390216 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc(C)c1C InChI=1S/C24H28N2O4/c1-14-5-4-6-17(15(14)2)13-26(12-16-7-8-16)18-9-21(30-3)22(25-11-18)23(27)19-10-20(19)24(28)29/h4-6,9,11,16,19-20H,7-8,10,12-13H2,1-3H3,(H,28,29) LRXJWJPKMGAWTD-UHFFFAOYSA-N 223253 2-(5-((Cyclopropylmethyl)(2,3-dimethylbenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 28::US9657001, 28 Leukotriene C4 synthase Homo sapiens 67 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223253 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223253&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670152 336285128 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390217 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(F)c(F)c1F InChI=1S/C22H21F3N2O4/c1-31-17-6-13(8-26-20(17)21(28)14-7-15(14)22(29)30)27(9-11-2-3-11)10-12-4-5-16(23)19(25)18(12)24/h4-6,8,11,14-15H,2-3,7,9-10H2,1H3,(H,29,30) GYFITMZTFUTBPG-UHFFFAOYSA-N 223254 2-(5-((Cyclopropylmethyl)(2,3,4-trifluorobenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 29::US9657001, 29 Leukotriene C4 synthase Homo sapiens 370 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223254 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223254&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670167 336285129 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390218 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(F)c(Cl)c1F InChI=1S/C22H21ClF2N2O4/c1-31-17-6-13(8-26-20(17)21(28)14-7-15(14)22(29)30)27(9-11-2-3-11)10-12-4-5-16(24)18(23)19(12)25/h4-6,8,11,14-15H,2-3,7,9-10H2,1H3,(H,29,30) LBXDHNIMLOJYEX-UHFFFAOYSA-N 223255 2-(5-((3-Chloro-2,4-difluorobenzyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 30::US9657001, 30 Leukotriene C4 synthase Homo sapiens 152 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223255 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223255&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670089 336285130 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390219 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1cccc(c1F)C(F)(F)F InChI=1S/C23H22F4N2O4/c1-33-18-7-14(9-28-20(18)21(30)15-8-16(15)22(31)32)29(10-12-5-6-12)11-13-3-2-4-17(19(13)24)23(25,26)27/h2-4,7,9,12,15-16H,5-6,8,10-11H2,1H3,(H,31,32) YIIXSZPWUKKBMP-UHFFFAOYSA-N 223256 2-(5-((Cyclopropylmethyl)(2-fluoro-3-(trifluoromethyl)benzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 31::US9657001, 31 Leukotriene C4 synthase Homo sapiens 331 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223256 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223256&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670131 336285131 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390220 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1c(F)ccc(C)c1F InChI=1S/C23H24F2N2O4/c1-12-3-6-18(24)17(20(12)25)11-27(10-13-4-5-13)14-7-19(31-2)21(26-9-14)22(28)15-8-16(15)23(29)30/h3,6-7,9,13,15-16H,4-5,8,10-11H2,1-2H3,(H,29,30) XCUVHFCZRLXWDA-UHFFFAOYSA-N 223257 2-(5-((Cyclopropylmethyl)(2,6-difluoro-3-methylbenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 32::US9657001, 32 Leukotriene C4 synthase Homo sapiens 1671 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223257 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223257&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670148 336285132 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390221 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(C)c(F)c1F InChI=1S/C23H24F2N2O4/c1-12-3-6-14(20(25)19(12)24)11-27(10-13-4-5-13)15-7-18(31-2)21(26-9-15)22(28)16-8-17(16)23(29)30/h3,6-7,9,13,16-17H,4-5,8,10-11H2,1-2H3,(H,29,30) YWMVCZZCXSWHGE-UHFFFAOYSA-N 223258 2-(5-((Cyclopropylmethyl)(2,3-difluoro-4-methylbenzyl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 33::US9657001, 33 Leukotriene C4 synthase Homo sapiens 185 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223258 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223258&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670145 336285133 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390222 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(c2ccccc12)C(F)(F)F InChI=1S/C26H23F3N2O4/c1-35-22-10-15(12-30-23(22)24(32)18-11-19(18)25(33)34)31(13-14-6-7-14)21-9-8-20(26(27,28)29)16-4-2-3-5-17(16)21/h2-5,8-10,12,14,18-19H,6-7,11,13H2,1H3,(H,33,34) UPEPYTCMMYVGIX-UHFFFAOYSA-N 223259 2-(5-((Cyclopropylmethyl)(4-(trifluoromethyl)naphthalen-1-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 34 Leukotriene C4 synthase Homo sapiens 19 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223259 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223259&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670157 336285134 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390223 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(c2cccnc12)C(F)(F)F InChI=1S/C25H22F3N3O4/c1-35-20-9-14(11-30-22(20)23(32)16-10-17(16)24(33)34)31(12-13-4-5-13)19-7-6-18(25(26,27)28)15-3-2-8-29-21(15)19/h2-3,6-9,11,13,16-17H,4-5,10,12H2,1H3,(H,33,34) PYVIIPWMEAHZFB-UHFFFAOYSA-N 223260 2-(5-((Cyclopropylmethyl)(5-(trifluoromethyl)quinolin-8-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 35::US9657001, 35 Leukotriene C4 synthase Homo sapiens 229 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223260 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223260&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670102 336285135 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390224 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc2CCc3cccc1c23 InChI=1S/C27H26N2O4/c1-33-23-11-18(13-28-25(23)26(30)20-12-21(20)27(31)32)29(14-15-5-6-15)22-10-9-17-8-7-16-3-2-4-19(22)24(16)17/h2-4,9-11,13,15,20-21H,5-8,12,14H2,1H3,(H,31,32) FQHWQFIPEVBFKT-UHFFFAOYSA-N 223261 2-(5-((Cyclopropylmethyl)(1,2-dihydroacenaphthylen-5-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 36::US9657001, 36 Leukotriene C4 synthase Homo sapiens 9 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223261 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223261&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670075 336285136 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390225 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1cccc2c(cccc12)C(F)(F)F InChI=1S/C26H23F3N2O4/c1-35-22-10-15(12-30-23(22)24(32)18-11-19(18)25(33)34)31(13-14-8-9-14)21-7-3-4-16-17(21)5-2-6-20(16)26(27,28)29/h2-7,10,12,14,18-19H,8-9,11,13H2,1H3,(H,33,34) UKSCYRKKQNMZQL-UHFFFAOYSA-N 223262 2-(5-((Cyclopropylmethyl)(5-(trifluoromethyl)naphthalen-1-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 37::US9657001, 37 Leukotriene C4 synthase Homo sapiens 25 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223262 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223262&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670144 336285137 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390226 COc1cc(cnc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc2cccc3CCc1c23 InChI=1S/C27H26N2O4/c1-33-23-11-18(13-28-25(23)26(30)20-12-21(20)27(31)32)29(14-15-5-6-15)22-10-8-17-4-2-3-16-7-9-19(22)24(16)17/h2-4,8,10-11,13,15,20-21H,5-7,9,12,14H2,1H3,(H,31,32) VUVDRPVJLHQYMJ-UHFFFAOYSA-N 223263 2-(5-((Cyclopropylmethyl)(1,2-dihydroacenaphthylen-3-yl)amino)-3-methoxypicolinoyl)cyclopropanecarboxylic acid::US20160326143, 38::US9657001, 38 Leukotriene C4 synthase Homo sapiens 31 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223263 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223263&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670142 336285138 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390227 COc1cc(cnc1C(=O)C1CC1C(=O)NS(=O)(=O)c1ccccc1)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C27H26ClN3O5S/c1-36-24-13-20(31(16-17-7-8-17)19-11-9-18(28)10-12-19)15-29-25(24)26(32)22-14-23(22)27(33)30-37(34,35)21-5-3-2-4-6-21/h2-6,9-13,15,17,22-23H,7-8,14,16H2,1H3,(H,30,33) RWHAGORGMHROPX-UHFFFAOYSA-N 223264 2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)-N-(phenylsulfonyl)cyclopropanecarboxamide::US20160326143, 39::US9657001, 39 Leukotriene C4 synthase Homo sapiens 68 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223264 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223264&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670127 336285139 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390228 COc1cc(cnc1C(=O)C1CC1C(=O)NS(=O)(=O)C1CC1)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C24H26ClN3O5S/c1-33-21-10-17(28(13-14-2-3-14)16-6-4-15(25)5-7-16)12-26-22(21)23(29)19-11-20(19)24(30)27-34(31,32)18-8-9-18/h4-7,10,12,14,18-20H,2-3,8-9,11,13H2,1H3,(H,27,30) WRQJEUJCLVYDJW-UHFFFAOYSA-N 223265 2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)-N-(cyclopropylsulfonyl)-cyclopropanecarboxamide::US20160326143, 40::US9657001, 40 Leukotriene C4 synthase Homo sapiens 356 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223265 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223265&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670155 336285140 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390229 COc1ccc(cc1)S(=O)(=O)NC(=O)C1CC1C(=O)c1ncc(cc1OC)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C28H28ClN3O6S/c1-37-21-9-11-22(12-10-21)39(35,36)31-28(34)24-14-23(24)27(33)26-25(38-2)13-20(15-30-26)32(16-17-3-4-17)19-7-5-18(29)6-8-19/h5-13,15,17,23-24H,3-4,14,16H2,1-2H3,(H,31,34) YCZGWTHYRDGLNJ-UHFFFAOYSA-N 223266 2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)-N-((4-methoxyphenyl)sulfonyl)-cyclopropanecarboxamide::US20160326143, 41::US9657001, 41 Leukotriene C4 synthase Homo sapiens 81 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223266 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223266&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670108 336285141 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390230 COc1cc(cnc1C(=O)C1CC1C(=O)NS(=O)(=O)c1ccc(OC(F)(F)F)cc1)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C28H25ClF3N3O6S/c1-40-24-12-19(35(15-16-2-3-16)18-6-4-17(29)5-7-18)14-33-25(24)26(36)22-13-23(22)27(37)34-42(38,39)21-10-8-20(9-11-21)41-28(30,31)32/h4-12,14,16,22-23H,2-3,13,15H2,1H3,(H,34,37) GJPBETSGPGBPTE-UHFFFAOYSA-N 223267 2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)-N-((4-(trifluoromethoxy)phenyl)-sulfonyl)cyclopropanecarboxamide::US20160326143, 42::US9657001, 42 Leukotriene C4 synthase Homo sapiens 277 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223267 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223267&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670134 336285142 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390231 COc1cc(cnc1C(=O)C1CC1C(=O)NS(=O)(=O)c1ccccc1F)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C27H25ClFN3O5S/c1-37-23-12-19(32(15-16-6-7-16)18-10-8-17(28)9-11-18)14-30-25(23)26(33)20-13-21(20)27(34)31-38(35,36)24-5-3-2-4-22(24)29/h2-5,8-12,14,16,20-21H,6-7,13,15H2,1H3,(H,31,34) MRGVLSMIFAMSBA-UHFFFAOYSA-N 223268 2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)-3-methoxypicolinoyl)-N-((2-fluorophenyl)sulfonyl)-cyclopropanecarboxamide::US20160326143, 43::US9657001, 43 Leukotriene C4 synthase Homo sapiens 74 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223268 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223268&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670107 336285143 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390232 COc1cc(ncc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(C)c2ccccc12 InChI=1S/C26H26N2O4/c1-15-7-10-22(18-6-4-3-5-17(15)18)28(14-16-8-9-16)24-12-23(32-2)21(13-27-24)25(29)19-11-20(19)26(30)31/h3-7,10,12-13,16,19-20H,8-9,11,14H2,1-2H3,(H,30,31) UEGPESZSLISMQC-UHFFFAOYSA-N 223269 2-(6-(Cyclopropylmethyl)(4-methylnaphthalen-1-yl)amino)-4-methoxynicotinoyl)cyclopropanecarboxylic acid::US20160326143, 44::US9657001, 44 Leukotriene C4 synthase Homo sapiens 56 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223269 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223269&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122679444 336285144 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390233 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(C)c2ccccc12 InChI=1S/C27H27NO4/c1-16-7-12-24(20-6-4-3-5-19(16)20)28(15-17-8-9-17)18-10-11-21(25(13-18)32-2)26(29)22-14-23(22)27(30)31/h3-7,10-13,17,22-23H,8-9,14-15H2,1-2H3,(H,30,31) PSJPNTJFVRAKAT-UHFFFAOYSA-N 223270 2-(4-((Cyclopropylmethyl)(4-methylnaphthalen-1-yl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 45::US9657001, 45 Leukotriene C4 synthase Homo sapiens 62 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223270 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223270&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670055 336285145 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390234 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(F)c2ccccc12 InChI=1S/C26H24FNO4/c1-32-24-12-16(8-9-19(24)25(29)20-13-21(20)26(30)31)28(14-15-6-7-15)23-11-10-22(27)17-4-2-3-5-18(17)23/h2-5,8-12,15,20-21H,6-7,13-14H2,1H3,(H,30,31) GUZAJKZMZHVTQP-UHFFFAOYSA-N 223271 2-(4-((Cyclopropylmethyl)(4-fluoronaphthalen-1-yl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 46::US9657001, 46 Leukotriene C4 synthase Homo sapiens 26 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223271 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223271&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670109 336285146 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390235 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(Cl)c2ccccc12 InChI=1S/C26H24ClNO4/c1-32-24-12-16(8-9-19(24)25(29)20-13-21(20)26(30)31)28(14-15-6-7-15)23-11-10-22(27)17-4-2-3-5-18(17)23/h2-5,8-12,15,20-21H,6-7,13-14H2,1H3,(H,30,31) VSZLJKUTHWUJMW-UHFFFAOYSA-N 223272 2-(4-((4-Chloronaphthalen-1-yl)(cyclopropylmethyl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 47::US9657001, 47 Leukotriene C4 synthase Homo sapiens 61 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223272 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223272&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670085 336285147 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390236 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1cccc2ccccc12 InChI=1S/C26H25NO4/c1-31-24-13-18(11-12-20(24)25(28)21-14-22(21)26(29)30)27(15-16-9-10-16)23-8-4-6-17-5-2-3-7-19(17)23/h2-8,11-13,16,21-22H,9-10,14-15H2,1H3,(H,29,30) VDEAONBMFRVCMV-UHFFFAOYSA-N 223273 2-(4-((Cyclopropylmethyl)(naphthalen-1-yl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 48::US9657001, 48 Leukotriene C4 synthase Homo sapiens 46 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223273 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223273&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670128 336285148 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390237 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C22H22ClNO4/c1-28-20-10-16(8-9-17(20)21(25)18-11-19(18)22(26)27)24(12-13-2-3-13)15-6-4-14(23)5-7-15/h4-10,13,18-19H,2-3,11-12H2,1H3,(H,26,27) GSWNQVGRAVLHBA-UHFFFAOYSA-N 223274 2-(4-((4-Chlorophenyl)(cyclopropylmethyl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 49::US9657001, 49 Leukotriene C4 synthase Homo sapiens 65 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223274 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223274&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670141 336285149 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390238 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(C)c(C)c1 InChI=1S/C24H27NO4/c1-14-4-7-17(10-15(14)2)25(13-16-5-6-16)18-8-9-19(22(11-18)29-3)23(26)20-12-21(20)24(27)28/h4,7-11,16,20-21H,5-6,12-13H2,1-3H3,(H,27,28) HYAQXBPDSJIQND-UHFFFAOYSA-N 223275 2-(4-((Cyclopropylmethyl)(3,4-dimethylphenyl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 50::US9657001, 50 Leukotriene C4 synthase Homo sapiens 75 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223275 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223275&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670126 336285150 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390239 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)Cc1ccc(Cl)cc1 InChI=1S/C23H24ClNO4/c1-29-21-10-17(8-9-18(21)22(26)19-11-20(19)23(27)28)25(12-14-2-3-14)13-15-4-6-16(24)7-5-15/h4-10,14,19-20H,2-3,11-13H2,1H3,(H,27,28) PWUXCBGKWGLWDX-UHFFFAOYSA-N 223276 2-(4-((4-Chlorobenzyl)(cyclopropylmethyl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 51::US9657001, 51 Leukotriene C4 synthase Homo sapiens 68 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223276 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223276&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670098 336285151 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390240 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(C)c2ncccc12 InChI=1S/C26H26N2O4/c1-15-5-10-22(18-4-3-11-27-24(15)18)28(14-16-6-7-16)17-8-9-19(23(12-17)32-2)25(29)20-13-21(20)26(30)31/h3-5,8-12,16,20-21H,6-7,13-14H2,1-2H3,(H,30,31) YGMRKTYGAXHDOV-UHFFFAOYSA-N 223277 2-(4-((Cyclopropylmethyl)(8-methylquinolin-5-yl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 52::US9657001, 52 Leukotriene C4 synthase Homo sapiens 359 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223277 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223277&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670053 336285152 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390241 COc1cc(ccc1C(=O)C1CC1C(O)=O)N(CC1CC1)c1ccc(c2cccnc12)C(F)(F)F InChI=1S/C26H23F3N2O4/c1-35-22-11-15(6-7-17(22)24(32)18-12-19(18)25(33)34)31(13-14-4-5-14)21-9-8-20(26(27,28)29)16-3-2-10-30-23(16)21/h2-3,6-11,14,18-19H,4-5,12-13H2,1H3,(H,33,34) JGYBRWIHTAPXFU-UHFFFAOYSA-N 223278 2-(4-((Cyclopropylmethyl)(5-(trifluoromethyl)quinolin-8-yl)amino)-2-methoxybenzoyl)cyclopropanecarboxylic acid::US20160326143, 53::US9657001, 53 Leukotriene C4 synthase Homo sapiens 152 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223278 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223278&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670066 336285153 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390242 OC(=O)C1CC1C(=O)c1ccc(cn1)N(CC1CC1)c1ccc(Cl)cc1 InChI=1S/C20H19ClN2O3/c21-13-3-5-14(6-4-13)23(11-12-1-2-12)15-7-8-18(22-10-15)19(24)16-9-17(16)20(25)26/h3-8,10,12,16-17H,1-2,9,11H2,(H,25,26) GUXNFOKWAUPOIK-UHFFFAOYSA-N 223279 2-(5-((4-Chlorophenyl)(cyclopropylmethyl)amino)picolinoyl)cyclopropanecarboxylic acid::US20160326143, 54::US9657001, 54 Leukotriene C4 synthase Homo sapiens 424 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223279 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223279&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670139 336285154 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390243 OC(=O)C1CC1C(=O)c1ccc(cn1)N(CC1CC1)Cc1ccc(Cl)cc1 InChI=1S/C21H21ClN2O3/c22-15-5-3-14(4-6-15)12-24(11-13-1-2-13)16-7-8-19(23-10-16)20(25)17-9-18(17)21(26)27/h3-8,10,13,17-18H,1-2,9,11-12H2,(H,26,27) PAOZWAQANPGPSX-UHFFFAOYSA-N 223280 2-(5-((4-Chlorobenzyl)(cyclopropylmethyl)amino)picolinoyl)cyclopropanecarboxylic acid::US20160326143, 55::US9657001, 55 Leukotriene C4 synthase Homo sapiens 636 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223280 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223280&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122673046 336285155 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390244 COc1nc(ncc1N(CC1CC1)c1ccc(Cl)c2ccccc12)C(=O)C1CC1C(O)=O InChI=1S/C24H22ClN3O4/c1-32-23-20(11-26-22(27-23)21(29)16-10-17(16)24(30)31)28(12-13-6-7-13)19-9-8-18(25)14-4-2-3-5-15(14)19/h2-5,8-9,11,13,16-17H,6-7,10,12H2,1H3,(H,30,31) DDLXCVVUOUQRRH-UHFFFAOYSA-N 223281 2-(5-((Cyclopropylmethyl)(naphthalen-1-yl)amino)-4-methoxypyrimidine-2-carbonyl)cyclopropanecarboxylic acid::US20160326143, 56::US9657001, 56 Leukotriene C4 synthase Homo sapiens 17 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223281 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223281&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670138 336285156 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390245 COc1nc(ncc1N(CC1CC1)c1cccc2ccccc12)C(=O)C1CC1C(O)=O InChI=1S/C24H23N3O4/c1-31-23-20(12-25-22(26-23)21(28)17-11-18(17)24(29)30)27(13-14-9-10-14)19-8-4-6-15-5-2-3-7-16(15)19/h2-8,12,14,17-18H,9-11,13H2,1H3,(H,29,30) QYPOYXFLLPVCEL-UHFFFAOYSA-N 223282 2-(5-((Cyclopropylmethyl)(naphthalen-1-yl)amino)-4-methoxypyrimidine-2-carbonyl)cyclopropanecarboxylic acid::US20160326143, 57::US9657001, 57 Leukotriene C4 synthase Homo sapiens 50 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223282 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223282&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search JUQ 6R7D 122670140 336285157 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390246 COc1nc(ncc1N(CC1CC1)c1ccc(F)c2ccccc12)C(=O)C1CC1C(O)=O InChI=1S/C24H22FN3O4/c1-32-23-20(11-26-22(27-23)21(29)16-10-17(16)24(30)31)28(12-13-6-7-13)19-9-8-18(25)14-4-2-3-5-15(14)19/h2-5,8-9,11,13,16-17H,6-7,10,12H2,1H3,(H,30,31) FQVKCACGQRZUTQ-UHFFFAOYSA-N 223283 2-(5-((Cyclopropylmethyl)(4-fluoronaphthalen-1-yl)amino)-4-methoxypyrimidine-2-carbonyl)cyclopropanecarboxylic acid::US20160326143, 58::US9657001, 58 Leukotriene C4 synthase Homo sapiens 19 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223283 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223283&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670077 336285158 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390247 COc1nc(ncc1N(CC1CC1)c1ccc(C)c2ccccc12)C(=O)C1CC1C(O)=O InChI=1S/C25H25N3O4/c1-14-7-10-20(17-6-4-3-5-16(14)17)28(13-15-8-9-15)21-12-26-23(27-24(21)32-2)22(29)18-11-19(18)25(30)31/h3-7,10,12,15,18-19H,8-9,11,13H2,1-2H3,(H,30,31) DZNDJYYQJOMNIM-UHFFFAOYSA-N 223284 2-(5-((Cyclopropylmethyl)(4-methylnaphthalen-1-yl)amino)-4-methoxypyrimidine-2-carbonyl)cyclopropanecarboxylic acid::US20160326143, 59::US9657001, 59 Leukotriene C4 synthase Homo sapiens 18 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223284 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223284&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670150 336285159 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390248 COc1cc(cnc1C(=O)C1CC1c1nnn[nH]1)N(CC1CC1)c1cccc2ccccc12 223285 (2-(1H-Tetrazol-5-yl)cyclopropyl)(5-((cyclopropylmethyl)(naphthalen-1-yl)amino)-3-methoxypyridin-2-yl)methanone::US20160326143, 60::US9657001, 60 Leukotriene C4 synthase Homo sapiens 96 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223285 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223285&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 126961662 336285160 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390249 COc1cc(cnc1C(=O)C1CC1c1nnn[nH]1)N(CC1CC1)c1ccc(F)c2ccccc12 223286 (2-(1H-Tetrazol-5-yl)cyclopropyl)(5-((cyclopropylmethyl)(4-fluoronaphthalen-1-yl)amino)-3-methoxypyridin-2-yl)methanone::US20160326143, 61::US9657001, 61 Leukotriene C4 synthase Homo sapiens 39 7.8 US Patent 10.7270/Q2W66JN5 aid1802651 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223286 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223286&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 126961663 336285161 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390250 COc1nc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC(C)(C)F)c1cc(Cl)c(F)cc1F InChI=1S/C20H19ClF3N3O4/c1-20(2,24)8-27(14-5-11(21)12(22)6-13(14)23)15-7-25-16(18(26-15)31-3)17(28)9-4-10(9)19(29)30/h5-7,9-10H,4,8H2,1-3H3,(H,29,30)/t9-,10-/m0/s1 RVMWIVNHZMXEHS-UWVGGRQHSA-N 223287 (1S,2S)-2-({5-[(5-Chloro-2,4-difluorophenyl)(2-fluoro-2-methylpropyl)amino]-3-methoxypyrazin-2-yl}carbonyl)cyclopropanecarboxylic acid::US20160326143, 62::US9657001, 62 Leukotriene C4 synthase Homo sapiens 0.289 7.5 US Patent 10.7270/Q2W66JN5 aid1802652 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223287 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223287&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670110 336285162 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390251 COc1nc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC(C)(C)F)c1cc(ccc1F)C(F)(F)F InChI=1S/C21H20F5N3O4/c1-20(2,23)9-29(14-6-10(21(24,25)26)4-5-13(14)22)15-8-27-16(18(28-15)33-3)17(30)11-7-12(11)19(31)32/h4-6,8,11-12H,7,9H2,1-3H3,(H,31,32)/t11-,12-/m0/s1 ACQYAZLJSNPFDC-RYUDHWBXSA-N 223288 (1S,2S)-2-[(5-{(2-Fluoro-2-methylpropyl)[2-fluoro-5-(trifluoromethyl)phenyl]amino}-3-methoxypyrazin-2-yl)carbonyl]cyclopropanecarboxylic acid::US20160326143, 63::US9657001, 63 Leukotriene C4 synthase Homo sapiens 0.248 7.5 US Patent 10.7270/Q2W66JN5 aid1802652 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223288 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223288&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670086 336285163 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390252 CCCN(c1cnc(C(=O)[C@H]2C[C@@H]2C(O)=O)c(OC)n1)c1cc(Cl)c(F)cc1F InChI=1S/C19H18ClF2N3O4/c1-3-4-25(14-6-11(20)12(21)7-13(14)22)15-8-23-16(18(24-15)29-2)17(26)9-5-10(9)19(27)28/h6-10H,3-5H2,1-2H3,(H,27,28)/t9-,10-/m0/s1 JBSBGXXISRQIMP-UWVGGRQHSA-N 223289 (1S,2S)-2-({5-[(5-Chloro-2,4-difluorophenyl)(propyl)amino]-3-methoxypyrazin-2-yl}carbonyl)cyclopropanecarboxylic acid::US20160326143, 64 Leukotriene C4 synthase Homo sapiens 0.483 7.5 US Patent 10.7270/Q2W66JN5 aid1802652 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223289 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223289&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670137 336285164 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18 390253 COc1cc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC(C)C)c1cc(ccc1F)C(F)(F)F InChI=1S/C22H22F4N2O4/c1-11(2)10-28(17-6-12(22(24,25)26)4-5-16(17)23)13-7-18(32-3)19(27-9-13)20(29)14-8-15(14)21(30)31/h4-7,9,11,14-15H,8,10H2,1-3H3,(H,30,31)/t14-,15-/m0/s1 SFZPOGKZJSDOJR-GJZGRUSLSA-N 223290 (1S,2S)-2-[(5-{[2-Fluoro-5-(trifluoromethyl)phenyl](2-methylpropyl)amino}-3-methoxypyridin-2-yl)carbonyl]cyclopropanecarboxylic acid::US20160326143, 65::US9657001, 65 Leukotriene C4 synthase Homo sapiens 0.658 7.5 US Patent 10.7270/Q2W66JN5 aid1802652 US20160326143 Ronn, R; Lindh, CJ; Ringberg, E; Andersson, HB; Nilsson, P; Schaal, WR; Rosenschold, MM; Nikitidis, A; Nikitidis, G; Johannesson, P; Tyrcha, C 11/10/2016 4/27/2017 AstraZeneca AB http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=223290 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50004882&target=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=223290&enzyme=Leukotriene+C4+synthase&column=ki&startPg=0&Increment=50&submit=Search 122670103 336285165 1 MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA 2PNO,2UUH,2UUI,3B29,3HKK,3PCV,4J7T,4J7Y,4JCZ,6R7D Leukotriene C4 synthase LTC4S_HUMAN Q16873 Q8N6P0 Q9UC73 Q9UD18