BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 374046 CN(C(=O)Nc1ccccc1-c1ccccc1)C1(CC1)C(O)=O InChI=1S/C18H18N2O3/c1-20(18(11-12-18)16(21)22)17(23)19-15-10-6-5-9-14(15)13-7-3-2-4-8-13/h2-10H,11-12H2,1H3,(H,19,23)(H,21,22) MYNNZZPCUCFPAT-UHFFFAOYSA-N 212446 US9278918, 32 Fatty acid-binding protein, adipocyte Human 4260 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212446 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212446&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270840 329728093 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374047 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)ccc1-c1ccccc1 InChI=1S/C19H19ClN2O3/c20-14-8-9-15(13-6-2-1-3-7-13)16(12-14)21-18(25)22-19(17(23)24)10-4-5-11-19/h1-3,6-9,12H,4-5,10-11H2,(H,23,24)(H2,21,22,25) YBQHFZNBCISVBS-UHFFFAOYSA-N 212447 US9278918, 33 Fatty acid-binding protein, adipocyte Human 150 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212447 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212447&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270841 329728094 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374048 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)ccc1-c1ccccc1 InChI=1S/C17H15ClN2O3/c18-12-6-7-13(11-4-2-1-3-5-11)14(10-12)19-16(23)20-17(8-9-17)15(21)22/h1-7,10H,8-9H2,(H,21,22)(H2,19,20,23) FMQBUMLPTSUNJJ-UHFFFAOYSA-N 212448 US9278918, 34 Fatty acid-binding protein, adipocyte Human 140 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212448 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212448&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270933 329728095 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374049 OC(=O)C1(CCC1)NC(=O)Nc1cc(Cl)ccc1-c1ccccc1 InChI=1S/C18H17ClN2O3/c19-13-7-8-14(12-5-2-1-3-6-12)15(11-13)20-17(24)21-18(16(22)23)9-4-10-18/h1-3,5-8,11H,4,9-10H2,(H,22,23)(H2,20,21,24) KCEPWWJSNUOSFO-UHFFFAOYSA-N 212449 US9278918, 35 Fatty acid-binding protein, adipocyte Human 810 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212449 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212449&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270935 329728096 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374050 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)ccc1-c1ccc(F)cc1 InChI=1S/C17H14ClFN2O3/c18-11-3-6-13(10-1-4-12(19)5-2-10)14(9-11)20-16(24)21-17(7-8-17)15(22)23/h1-6,9H,7-8H2,(H,22,23)(H2,20,21,24) GVYODSAQRBLPBQ-UHFFFAOYSA-N 212450 US9278918, 40 Fatty acid-binding protein, adipocyte Human 330 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212450 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212450&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270937 329728097 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374051 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)ccc1-c1ccc(F)cc1 InChI=1S/C19H18ClFN2O3/c20-13-5-8-15(12-3-6-14(21)7-4-12)16(11-13)22-18(26)23-19(17(24)25)9-1-2-10-19/h3-8,11H,1-2,9-10H2,(H,24,25)(H2,22,23,26) PDTYXZFDMKYTCF-UHFFFAOYSA-N 212451 US9278918, 41 Fatty acid-binding protein, adipocyte Human 140 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212451 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212451&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270934 329728098 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374052 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)c(F)cc1-c1ccccc1 InChI=1S/C17H14ClFN2O3/c18-12-9-14(20-16(24)21-17(6-7-17)15(22)23)11(8-13(12)19)10-4-2-1-3-5-10/h1-5,8-9H,6-7H2,(H,22,23)(H2,20,21,24) NCEAGHYBYGWNMV-UHFFFAOYSA-N 212452 US9278918, 42 Fatty acid-binding protein, adipocyte Human 60 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212452 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212452&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270936 329728099 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374053 OC(=O)C1(CC1)NC(=O)Nc1ccc(Cl)cc1-c1ccccc1 InChI=1S/C17H15ClN2O3/c18-12-6-7-14(13(10-12)11-4-2-1-3-5-11)19-16(23)20-17(8-9-17)15(21)22/h1-7,10H,8-9H2,(H,21,22)(H2,19,20,23) BUNMXOSASAYWTL-UHFFFAOYSA-N 212453 US9278918, 43 Fatty acid-binding protein, adipocyte Human 890 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212453 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212453&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270938 329728100 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374054 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)c(F)cc1-c1ccccc1 InChI=1S/C19H18ClFN2O3/c20-14-11-16(13(10-15(14)21)12-6-2-1-3-7-12)22-18(26)23-19(17(24)25)8-4-5-9-19/h1-3,6-7,10-11H,4-5,8-9H2,(H,24,25)(H2,22,23,26) OZCRNUIWAXZIST-UHFFFAOYSA-N 212454 US9278918, 44 Fatty acid-binding protein, adipocyte Human 100 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212454 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212454&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86270939 329728101 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374055 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)cc(Cl)c1-c1ccccc1 InChI=1S/C17H14Cl2N2O3/c18-11-8-12(19)14(10-4-2-1-3-5-10)13(9-11)20-16(24)21-17(6-7-17)15(22)23/h1-5,8-9H,6-7H2,(H,22,23)(H2,20,21,24) JSFFCHMELRJRQJ-UHFFFAOYSA-N 212455 US9278918, 45 Fatty acid-binding protein, adipocyte Human 80 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212455 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212455&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86271031 329728102 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374056 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)cc(Cl)c1-c1ccccc1 InChI=1S/C19H18Cl2N2O3/c20-13-10-14(21)16(12-6-2-1-3-7-12)15(11-13)22-18(26)23-19(17(24)25)8-4-5-9-19/h1-3,6-7,10-11H,4-5,8-9H2,(H,24,25)(H2,22,23,26) XKZSVPIUPDFCIQ-UHFFFAOYSA-N 212456 US9278918, 46 Fatty acid-binding protein, adipocyte Human 50 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212456 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212456&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 78319116 329728103 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374057 OC(=O)C1(CCCC1)NC(=O)Nc1cc(ccc1-c1ccccc1)C(F)(F)F InChI=1S/C20H19F3N2O3/c21-20(22,23)14-8-9-15(13-6-2-1-3-7-13)16(12-14)24-18(28)25-19(17(26)27)10-4-5-11-19/h1-3,6-9,12H,4-5,10-11H2,(H,26,27)(H2,24,25,28) LZSZOARSNJNBDV-UHFFFAOYSA-N 212457 US9278918, 47 Fatty acid-binding protein, adipocyte Human 520 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212457 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212457&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86271032 329728104 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374058 OC(=O)C1(CC1)NC(=O)Nc1cc(ccc1-c1ccccc1)C(F)(F)F InChI=1S/C18H15F3N2O3/c19-18(20,21)12-6-7-13(11-4-2-1-3-5-11)14(10-12)22-16(26)23-17(8-9-17)15(24)25/h1-7,10H,8-9H2,(H,24,25)(H2,22,23,26) WRYIDIDIYPDNAK-UHFFFAOYSA-N 212458 US9278918, 48 Fatty acid-binding protein, adipocyte Human 950 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212458 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212458&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86271033 329728105 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374059 OC(=O)C1(CCCC1)NC(=O)Nc1ccc(Cl)cc1-c1ccc(F)cc1 InChI=1S/C19H18ClFN2O3/c20-13-5-8-16(15(11-13)12-3-6-14(21)7-4-12)22-18(26)23-19(17(24)25)9-1-2-10-19/h3-8,11H,1-2,9-10H2,(H,24,25)(H2,22,23,26) AMXBJTAOGMCYMX-UHFFFAOYSA-N 212459 US9278918, 49 Fatty acid-binding protein, adipocyte Human 750 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212459 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212459&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86271034 329728106 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374060 OC(=O)C1(CC1)NC(=O)Nc1ccc(Cl)cc1-c1ccc(F)cc1 InChI=1S/C17H14ClFN2O3/c18-11-3-6-14(13(9-11)10-1-4-12(19)5-2-10)20-16(24)21-17(7-8-17)15(22)23/h1-6,9H,7-8H2,(H,22,23)(H2,20,21,24) UVMXRPXVZLAUGO-UHFFFAOYSA-N 212460 US9278918, 50 Fatty acid-binding protein, adipocyte Human 290 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212460 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212460&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86271035 329728107 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374061 OC(=O)C1(CCCC1)NC(=O)Nc1ccc(Cl)cc1-c1ccccc1 InChI=1S/C19H19ClN2O3/c20-14-8-9-16(15(12-14)13-6-2-1-3-7-13)21-18(25)22-19(17(23)24)10-4-5-11-19/h1-3,6-9,12H,4-5,10-11H2,(H,23,24)(H2,21,22,25) VEQGYZXEIAPKOP-UHFFFAOYSA-N 212461 US9278918, 51 Fatty acid-binding protein, adipocyte Human 1350 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212461 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8873&target=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212461&enzyme=Fatty+acid-binding+protein%2C+adipocyte&column=ki&startPg=0&Increment=50&submit=Search 86271036 329728108 1 MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA 1TOU,1TOW,2HNX,2NNQ,2Q9S,2QM9,3FR2,3FR4,3FR5,3P6C,3P6D,3P6E,3P6F,3P6G,3P6H,3Q6L,3RZY,4NNS,4NNT,5C0N,5D45,5D47,5D48,5D4A,5D8J,5EDB,5EDC,5HZ6,5Y0F,5Y0G,5Y0X,5Y12,5Y13,6AYL,6LJS,6LJT,6LJU,6LJV,6LJW,6LJX,7FVU,7FVV,7FVW,7FVX,7FVY,7FVZ,7FW0,7FW1,7FW2,7FW3,7FW4,7FW6,7FW7,7FW9,7FWA,7FWB,7FWC,7FWD,7FWE,7FWG,7FWH,7FWJ,7FWK,7FWL,7FWN,7FWO,7FWP,7FWR,7FWS,7FWT,7FWU,7FWW,7FWY,7FWZ,7FX0,7FX1,7FX3,7FX4,7FX5,7FX6,7FX8,7FX9,7FXA,7FXB,7FXC,7FXE,7FXF,7FXG,7FXH,7FXI,7FXJ,7FXK,7FXM,7FXN,7FXP,7FXQ,7FXR,7FXT,7FXU,7FXV,7FXW,7FXY,7FXZ,7FY2,7FY3,7FY5,7FY6,7FY7,7FYB,7FYC,7FYE,7FYF,7FYG,7FYI,7FYJ,7FYK,7FYL,7FYO,7FYP,7FYQ,7FYR,7FYS,7FYT,7FYU,7FYV,7FYX,7FYY,7FYZ,7FZ0,7FZ1,7FZ2,7FZ3,7FZ4,7FZ5,7FZ6,7FZ7,7FZ8,7FZ9,7FZA,7FZB,7FZC,7FZD,7FZE,7FZF,7FZG,7FZH,7FZI,7FZJ,7FZL,7FZM,7FZN,7FZO,7FZP,7FZR,7FZS,7FZV,7FZW,7FZX,7FZY,7FZZ,7G02,7G03,7G05,7G06,7G07,7G08,7G09,7G0A,7G0F,7G0G,7G0H,7G0I,7G0J,7G0K,7G0L,7G0M,7G0N,7G0P,7G0Q,7G0R,7G0S,7G0T,7G0U,7G0V,7G0Y,7G11,7G14,7G16,7G17,7G18,7G19,7G1A,7G1B,7G1C,7G1D,7G1E,7G1F,7G1G,7G1H,7G1I,7G1J,7G1K,7G1L,7G1N,7G1O,7G1R,7G1S,7G1T,7G1U,7G1V,7G1Y,7G1Z,7G20,7G21,7WC3 Fatty acid-binding protein, adipocyte FABP4_HUMAN P15090 Q6IBA1 374062 CN(C(=O)Nc1ccccc1-c1ccccc1)C1(CC1)C(O)=O InChI=1S/C18H18N2O3/c1-20(18(11-12-18)16(21)22)17(23)19-15-10-6-5-9-14(15)13-7-3-2-4-8-13/h2-10H,11-12H2,1H3,(H,19,23)(H,21,22) MYNNZZPCUCFPAT-UHFFFAOYSA-N 212446 US9278918, 32 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212446 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212446&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270840 329728093 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374063 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)ccc1-c1ccccc1 InChI=1S/C19H19ClN2O3/c20-14-8-9-15(13-6-2-1-3-7-13)16(12-14)21-18(25)22-19(17(23)24)10-4-5-11-19/h1-3,6-9,12H,4-5,10-11H2,(H,23,24)(H2,21,22,25) YBQHFZNBCISVBS-UHFFFAOYSA-N 212447 US9278918, 33 Fatty acid-binding protein 5 Human 23620 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212447 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212447&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270841 329728094 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374064 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)ccc1-c1ccccc1 InChI=1S/C17H15ClN2O3/c18-12-6-7-13(11-4-2-1-3-5-11)14(10-12)19-16(23)20-17(8-9-17)15(21)22/h1-7,10H,8-9H2,(H,21,22)(H2,19,20,23) FMQBUMLPTSUNJJ-UHFFFAOYSA-N 212448 US9278918, 34 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212448 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212448&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270933 329728095 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374065 OC(=O)C1(CCC1)NC(=O)Nc1cc(Cl)ccc1-c1ccccc1 InChI=1S/C18H17ClN2O3/c19-13-7-8-14(12-5-2-1-3-6-12)15(11-13)20-17(24)21-18(16(22)23)9-4-10-18/h1-3,5-8,11H,4,9-10H2,(H,22,23)(H2,20,21,24) KCEPWWJSNUOSFO-UHFFFAOYSA-N 212449 US9278918, 35 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212449 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212449&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270935 329728096 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374066 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)ccc1-c1ccc(F)cc1 InChI=1S/C17H14ClFN2O3/c18-11-3-6-13(10-1-4-12(19)5-2-10)14(9-11)20-16(24)21-17(7-8-17)15(22)23/h1-6,9H,7-8H2,(H,22,23)(H2,20,21,24) GVYODSAQRBLPBQ-UHFFFAOYSA-N 212450 US9278918, 40 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212450 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212450&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270937 329728097 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374067 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)ccc1-c1ccc(F)cc1 InChI=1S/C19H18ClFN2O3/c20-13-5-8-15(12-3-6-14(21)7-4-12)16(11-13)22-18(26)23-19(17(24)25)9-1-2-10-19/h3-8,11H,1-2,9-10H2,(H,24,25)(H2,22,23,26) PDTYXZFDMKYTCF-UHFFFAOYSA-N 212451 US9278918, 41 Fatty acid-binding protein 5 Human 19560 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212451 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212451&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270934 329728098 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374068 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)c(F)cc1-c1ccccc1 InChI=1S/C17H14ClFN2O3/c18-12-9-14(20-16(24)21-17(6-7-17)15(22)23)11(8-13(12)19)10-4-2-1-3-5-10/h1-5,8-9H,6-7H2,(H,22,23)(H2,20,21,24) NCEAGHYBYGWNMV-UHFFFAOYSA-N 212452 US9278918, 42 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212452 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212452&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270936 329728099 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374069 OC(=O)C1(CC1)NC(=O)Nc1ccc(Cl)cc1-c1ccccc1 InChI=1S/C17H15ClN2O3/c18-12-6-7-14(13(10-12)11-4-2-1-3-5-11)19-16(23)20-17(8-9-17)15(21)22/h1-7,10H,8-9H2,(H,21,22)(H2,19,20,23) BUNMXOSASAYWTL-UHFFFAOYSA-N 212453 US9278918, 43 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212453 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212453&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270938 329728100 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374070 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)c(F)cc1-c1ccccc1 InChI=1S/C19H18ClFN2O3/c20-14-11-16(13(10-15(14)21)12-6-2-1-3-7-12)22-18(26)23-19(17(24)25)8-4-5-9-19/h1-3,6-7,10-11H,4-5,8-9H2,(H,24,25)(H2,22,23,26) OZCRNUIWAXZIST-UHFFFAOYSA-N 212454 US9278918, 44 Fatty acid-binding protein 5 Human 13670 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212454 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212454&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86270939 329728101 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374071 OC(=O)C1(CC1)NC(=O)Nc1cc(Cl)cc(Cl)c1-c1ccccc1 InChI=1S/C17H14Cl2N2O3/c18-11-8-12(19)14(10-4-2-1-3-5-10)13(9-11)20-16(24)21-17(6-7-17)15(22)23/h1-5,8-9H,6-7H2,(H,22,23)(H2,20,21,24) JSFFCHMELRJRQJ-UHFFFAOYSA-N 212455 US9278918, 45 Fatty acid-binding protein 5 Human 28260 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212455 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212455&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86271031 329728102 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374072 OC(=O)C1(CCCC1)NC(=O)Nc1cc(Cl)cc(Cl)c1-c1ccccc1 InChI=1S/C19H18Cl2N2O3/c20-13-10-14(21)16(12-6-2-1-3-7-12)15(11-13)22-18(26)23-19(17(24)25)8-4-5-9-19/h1-3,6-7,10-11H,4-5,8-9H2,(H,24,25)(H2,22,23,26) XKZSVPIUPDFCIQ-UHFFFAOYSA-N 212456 US9278918, 46 Fatty acid-binding protein 5 Human 3790 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212456 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212456&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 78319116 329728103 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374073 OC(=O)C1(CCCC1)NC(=O)Nc1cc(ccc1-c1ccccc1)C(F)(F)F InChI=1S/C20H19F3N2O3/c21-20(22,23)14-8-9-15(13-6-2-1-3-7-13)16(12-14)24-18(28)25-19(17(26)27)10-4-5-11-19/h1-3,6-9,12H,4-5,10-11H2,(H,26,27)(H2,24,25,28) LZSZOARSNJNBDV-UHFFFAOYSA-N 212457 US9278918, 47 Fatty acid-binding protein 5 Human 6350 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212457 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212457&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86271032 329728104 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374074 OC(=O)C1(CC1)NC(=O)Nc1cc(ccc1-c1ccccc1)C(F)(F)F InChI=1S/C18H15F3N2O3/c19-18(20,21)12-6-7-13(11-4-2-1-3-5-11)14(10-12)22-16(26)23-17(8-9-17)15(24)25/h1-7,10H,8-9H2,(H,24,25)(H2,22,23,26) WRYIDIDIYPDNAK-UHFFFAOYSA-N 212458 US9278918, 48 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212458 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212458&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86271033 329728105 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374075 OC(=O)C1(CCCC1)NC(=O)Nc1ccc(Cl)cc1-c1ccc(F)cc1 InChI=1S/C19H18ClFN2O3/c20-13-5-8-16(15(11-13)12-3-6-14(21)7-4-12)22-18(26)23-19(17(24)25)9-1-2-10-19/h3-8,11H,1-2,9-10H2,(H,24,25)(H2,22,23,26) AMXBJTAOGMCYMX-UHFFFAOYSA-N 212459 US9278918, 49 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212459 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212459&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86271034 329728106 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374076 OC(=O)C1(CC1)NC(=O)Nc1ccc(Cl)cc1-c1ccc(F)cc1 InChI=1S/C17H14ClFN2O3/c18-11-3-6-14(13(9-11)10-1-4-12(19)5-2-10)20-16(24)21-17(7-8-17)15(22)23/h1-6,9H,7-8H2,(H,22,23)(H2,20,21,24) UVMXRPXVZLAUGO-UHFFFAOYSA-N 212460 US9278918, 50 Fatty acid-binding protein 5 Human >50000 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212460 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212460&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86271035 329728107 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0 374077 OC(=O)C1(CCCC1)NC(=O)Nc1ccc(Cl)cc1-c1ccccc1 InChI=1S/C19H19ClN2O3/c20-14-8-9-16(15(12-14)13-6-2-1-3-7-13)21-18(25)22-19(17(23)24)10-4-5-11-19/h1-3,6-9,12H,4-5,10-11H2,(H,23,24)(H2,21,22,25) VEQGYZXEIAPKOP-UHFFFAOYSA-N 212461 US9278918, 51 Fatty acid-binding protein 5 Human 17100 7.5 25.00 C US Patent 10.7270/Q28914P6 aid1802384 US9278918 Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H 3/8/2016 2/13/2017 Hoffmann-La Roche Inc http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=212461 http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=8874&target=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=212461&enzyme=Fatty+acid-binding+protein+5&column=ki&startPg=0&Increment=50&submit=Search 86271036 329728108 1 MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE 1JJJ,4AZM,4LKP,4LKT,5HZ5,5UR9,7FWI,7FXD,7FY0,7FYD,7G01,7G04,7G0B,7G0E,7G1Q Fatty acid-binding protein 5 FABP5_HUMAN Q01469 B2R4K0