BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 302113 Cc1cncn1CCCn1c(=S)[nH]c2ccccc2c1=O InChI=1S/C15H16N4OS/c1-11-9-16-10-18(11)7-4-8-19-14(20)12-5-2-3-6-13(12)17-15(19)21/h2-3,5-6,9-10H,4,7-8H2,1H3,(H,17,21) OCZNDAJRFTWXOB-UHFFFAOYSA-N 159348 US9034907, 1 Glutaminyl-peptide cyclotransferase Homo sapiens 11.6 92.3 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159348 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159348&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594275 277285318 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302114 Cc1cncn1CCCn1c(=S)[nH]c2c(C)csc2c1=O InChI=1S/C14H16N4OS2/c1-9-7-21-12-11(9)16-14(20)18(13(12)19)5-3-4-17-8-15-6-10(17)2/h6-8H,3-5H2,1-2H3,(H,16,20) HPEMGQBCIGEXJW-UHFFFAOYSA-N 159349 US9034907, 2 Glutaminyl-peptide cyclotransferase Homo sapiens 113 255 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159349 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159349&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594276 277285319 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302115 Cc1cncn1CCCn1c(=S)[nH]c2sc3CCCCc3c2c1=O InChI=1S/C17H20N4OS2/c1-11-9-18-10-20(11)7-4-8-21-16(22)14-12-5-2-3-6-13(12)24-15(14)19-17(21)23/h9-10H,2-8H2,1H3,(H,19,23) CTWINDSEZLAOLO-UHFFFAOYSA-N 159350 US9034907, 3 Glutaminyl-peptide cyclotransferase Homo sapiens 17.3 113 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159350 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159350&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594277 277285320 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302116 CCc1cc2c([nH]c(=S)n(CCCn3cncc3C)c2=O)s1 InChI=1S/C15H18N4OS2/c1-3-11-7-12-13(22-11)17-15(21)19(14(12)20)6-4-5-18-9-16-8-10(18)2/h7-9H,3-6H2,1-2H3,(H,17,21) IGZJRENKTGZKTI-UHFFFAOYSA-N 159351 US9034907, 4 Glutaminyl-peptide cyclotransferase Homo sapiens 25 115 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159351&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594278 277285321 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302117 Cc1cncn1CCCn1c(=S)[nH]c2sc(C)c(C)c2c1=O InChI=1S/C15H18N4OS2/c1-9-7-16-8-18(9)5-4-6-19-14(20)12-10(2)11(3)22-13(12)17-15(19)21/h7-8H,4-6H2,1-3H3,(H,17,21) QDYKVYPLCVABGE-UHFFFAOYSA-N 159352 US9034907, 5 Glutaminyl-peptide cyclotransferase Homo sapiens 24.1 122 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159352&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594279 277285322 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302118 CCc1c(C)sc2[nH]c(=S)n(CCCn3cncc3C)c(=O)c12 InChI=1S/C16H20N4OS2/c1-4-12-11(3)23-14-13(12)15(21)20(16(22)18-14)7-5-6-19-9-17-8-10(19)2/h8-9H,4-7H2,1-3H3,(H,18,22) WGMGWVRMAYEMKZ-UHFFFAOYSA-N 159353 US9034907, 6 Glutaminyl-peptide cyclotransferase Homo sapiens 30.8 162 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159353 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159353&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594280 277285323 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302119 Cc1cncn1CCCn1c(=S)[nH]c2sc(cc2c1=O)-c1ccccc1 InChI=1S/C19H18N4OS2/c1-13-11-20-12-22(13)8-5-9-23-18(24)15-10-16(14-6-3-2-4-7-14)26-17(15)21-19(23)25/h2-4,6-7,10-12H,5,8-9H2,1H3,(H,21,25) WHIZZFBTPLZQRE-UHFFFAOYSA-N 159354 US9034907, 7 Glutaminyl-peptide cyclotransferase Homo sapiens 21.1 124 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159354 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159354&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594281 277285324 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302120 Cc1cncn1CCCn1c(=S)[nH]c2sc3CCCc3c2c1=O InChI=1S/C16H18N4OS2/c1-10-8-17-9-19(10)6-3-7-20-15(21)13-11-4-2-5-12(11)23-14(13)18-16(20)22/h8-9H,2-7H2,1H3,(H,18,22) FDJHBRGEGAISKB-UHFFFAOYSA-N 159355 US9034907, 8 Glutaminyl-peptide cyclotransferase Homo sapiens 21.7 207 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159355 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159355&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594282 277285325 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302121 CC1CCc2c(C1)sc1[nH]c(=S)n(CCCn3cncc3C)c(=O)c21 InChI=1S/C18H22N4OS2/c1-11-4-5-13-14(8-11)25-16-15(13)17(23)22(18(24)20-16)7-3-6-21-10-19-9-12(21)2/h9-11H,3-8H2,1-2H3,(H,20,24) KVEARTDQFDOZSV-UHFFFAOYSA-N 159356 US9034907, 9 Glutaminyl-peptide cyclotransferase Homo sapiens 43.5 282 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159356&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594283 277285326 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302122 Cc1cncn1CCCn1c(=S)[nH]c2sc3CCCCCc3c2c1=O InChI=1S/C18H22N4OS2/c1-12-10-19-11-21(12)8-5-9-22-17(23)15-13-6-3-2-4-7-14(13)25-16(15)20-18(22)24/h10-11H,2-9H2,1H3,(H,20,24) NLQKTJPRILIYSB-UHFFFAOYSA-N 159357 US9034907, 10 Glutaminyl-peptide cyclotransferase Homo sapiens 25.1 132 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159357 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159357&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594284 277285327 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302123 Cc1cncn1CCCn1c(=S)[nH]c2sc3CCCCCCc3c2c1=O InChI=1S/C19H24N4OS2/c1-13-11-20-12-22(13)9-6-10-23-18(24)16-14-7-4-2-3-5-8-15(14)26-17(16)21-19(23)25/h11-12H,2-10H2,1H3,(H,21,25) RUXPVUOUZBSEBR-UHFFFAOYSA-N 159358 US9034907, 11 Glutaminyl-peptide cyclotransferase Homo sapiens 28.5 170 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159358 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159358&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594285 277285328 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302124 Cc1cncn1CCCn1c(=S)[nH]c2sc(C)c(-c3ccccc3)c2c1=O InChI=1S/C20H20N4OS2/c1-13-11-21-12-23(13)9-6-10-24-19(25)17-16(15-7-4-3-5-8-15)14(2)27-18(17)22-20(24)26/h3-5,7-8,11-12H,6,9-10H2,1-2H3,(H,22,26) KNJXAJSZJKPCFF-UHFFFAOYSA-N 159359 US9034907, 12 Glutaminyl-peptide cyclotransferase Homo sapiens 79.7 434 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159359 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159359&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594286 277285329 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302125 Cc1cncn1CCCn1c(=S)[nH]c2sc(Cc3ccccc3)cc2c1=O InChI=1S/C20H20N4OS2/c1-14-12-21-13-23(14)8-5-9-24-19(25)17-11-16(27-18(17)22-20(24)26)10-15-6-3-2-4-7-15/h2-4,6-7,11-13H,5,8-10H2,1H3,(H,22,26) BJRCKWGSNLJJTB-UHFFFAOYSA-N 159360 US9034907, 13 Glutaminyl-peptide cyclotransferase Homo sapiens 18.9 96.2 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159360 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159360&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594287 277285330 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302126 Cc1cn(CCCn2c(=S)[nH]c3ccccc3c2=O)cn1 InChI=1S/C15H16N4OS/c1-11-9-18(10-16-11)7-4-8-19-14(20)12-5-2-3-6-13(12)17-15(19)21/h2-3,5-6,9-10H,4,7-8H2,1H3,(H,17,21) KVMHBFZMWNXGQU-UHFFFAOYSA-N 159361 US9034907, 14 Glutaminyl-peptide cyclotransferase Homo sapiens 229 2460 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159361 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159361&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594288 277285331 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302127 Cc1cn(CCCn2c(=S)[nH]c3c(C)csc3c2=O)cn1 InChI=1S/C14H16N4OS2/c1-9-7-21-12-11(9)16-14(20)18(13(12)19)5-3-4-17-6-10(2)15-8-17/h6-8H,3-5H2,1-2H3,(H,16,20) YYBYVCGXQFLTMI-UHFFFAOYSA-N 159362 US9034907, 15 Glutaminyl-peptide cyclotransferase Homo sapiens 285 3180 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159362 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159362&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594289 277285332 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302128 Cc1cn(CCCn2c(=S)[nH]c3sc4CCCCc4c3c2=O)cn1 InChI=1S/C17H20N4OS2/c1-11-9-20(10-18-11)7-4-8-21-16(22)14-12-5-2-3-6-13(12)24-15(14)19-17(21)23/h9-10H,2-8H2,1H3,(H,19,23) JSZNAMSCKDGNDJ-UHFFFAOYSA-N 159363 US9034907, 16 Glutaminyl-peptide cyclotransferase Homo sapiens 307 3240 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159363 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159363&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594290 277285333 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302129 CCc1cc2c([nH]c(=S)n(CCCn3cnc(C)c3)c2=O)s1 InChI=1S/C15H18N4OS2/c1-3-11-7-12-13(22-11)17-15(21)19(14(12)20)6-4-5-18-8-10(2)16-9-18/h7-9H,3-6H2,1-2H3,(H,17,21) NCRALJCQWCAWFI-UHFFFAOYSA-N 159364 US9034907, 17 Glutaminyl-peptide cyclotransferase Homo sapiens 417 1970 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159364 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159364&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594291 277285334 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302130 Cc1cn(CCCn2c(=S)[nH]c3sc(C)c(C)c3c2=O)cn1 InChI=1S/C15H18N4OS2/c1-9-7-18(8-16-9)5-4-6-19-14(20)12-10(2)11(3)22-13(12)17-15(19)21/h7-8H,4-6H2,1-3H3,(H,17,21) QLZLIPFTBQEVGQ-UHFFFAOYSA-N 159365 US9034907, 18 Glutaminyl-peptide cyclotransferase Homo sapiens 682 3300 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159365 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159365&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594292 277285335 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302131 CCc1c(C)sc2[nH]c(=S)n(CCCn3cnc(C)c3)c(=O)c12 InChI=1S/C16H20N4OS2/c1-4-12-11(3)23-14-13(12)15(21)20(16(22)18-14)7-5-6-19-8-10(2)17-9-19/h8-9H,4-7H2,1-3H3,(H,18,22) QQTKYDPTXNKNOO-UHFFFAOYSA-N 159366 US9034907, 19 Glutaminyl-peptide cyclotransferase Homo sapiens 1240 8230 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159366 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159366&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594293 277285336 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302132 Cc1cn(CCCn2c(=S)[nH]c3sc(cc3c2=O)-c2ccccc2)cn1 InChI=1S/C19H18N4OS2/c1-13-11-22(12-20-13)8-5-9-23-18(24)15-10-16(14-6-3-2-4-7-14)26-17(15)21-19(23)25/h2-4,6-7,10-12H,5,8-9H2,1H3,(H,21,25) SUEZJTASQILVKW-UHFFFAOYSA-N 159367 US9034907, 20 Glutaminyl-peptide cyclotransferase Homo sapiens 1470 5580 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159367 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159367&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594294 277285337 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302133 Cc1cn(CCCn2c(=S)[nH]c3sc4CCCc4c3c2=O)cn1 InChI=1S/C16H18N4OS2/c1-10-8-19(9-17-10)6-3-7-20-15(21)13-11-4-2-5-12(11)23-14(13)18-16(20)22/h8-9H,2-7H2,1H3,(H,18,22) QVKGCJLHTYPXDH-UHFFFAOYSA-N 159368 US9034907, 21 Glutaminyl-peptide cyclotransferase Homo sapiens 1290 6750 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159368 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159368&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594295 277285338 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302134 CC1CCc2c(C1)sc1[nH]c(=S)n(CCCn3cnc(C)c3)c(=O)c21 InChI=1S/C18H22N4OS2/c1-11-4-5-13-14(8-11)25-16-15(13)17(23)22(18(24)20-16)7-3-6-21-9-12(2)19-10-21/h9-11H,3-8H2,1-2H3,(H,20,24) PYQINQYKRFNEDD-UHFFFAOYSA-N 159369 US9034907, 22 Glutaminyl-peptide cyclotransferase Homo sapiens 430 2320 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159369 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159369&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594296 277285339 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302135 Cc1cn(CCCn2c(=S)[nH]c3sc4CCCCCc4c3c2=O)cn1 InChI=1S/C18H22N4OS2/c1-12-10-21(11-19-12)8-5-9-22-17(23)15-13-6-3-2-4-7-14(13)25-16(15)20-18(22)24/h10-11H,2-9H2,1H3,(H,20,24) JRSRMBMCNVIWDS-UHFFFAOYSA-N 159370 US9034907, 23 Glutaminyl-peptide cyclotransferase Homo sapiens 964 5240 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159370 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159370&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594297 277285340 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302136 Cc1cn(CCCn2c(=S)[nH]c3sc4CCCCCCc4c3c2=O)cn1 InChI=1S/C19H24N4OS2/c1-13-11-22(12-20-13)9-6-10-23-18(24)16-14-7-4-2-3-5-8-15(14)26-17(16)21-19(23)25/h11-12H,2-10H2,1H3,(H,21,25) BGDPLDYXJZZLFQ-UHFFFAOYSA-N 159371 US9034907, 24 Glutaminyl-peptide cyclotransferase Homo sapiens 632 2690 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159371 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159371&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594298 277285341 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302137 Cc1cn(CCCn2c(=S)[nH]c3sc(C)c(-c4ccccc4)c3c2=O)cn1 InChI=1S/C20H20N4OS2/c1-13-11-23(12-21-13)9-6-10-24-19(25)17-16(15-7-4-3-5-8-15)14(2)27-18(17)22-20(24)26/h3-5,7-8,11-12H,6,9-10H2,1-2H3,(H,22,26) FRMVXFSWVZWRJK-UHFFFAOYSA-N 159372 US9034907, 25 Glutaminyl-peptide cyclotransferase Homo sapiens 971 9830 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159372 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159372&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594299 277285342 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302138 Cc1cn(CCCn2c(=S)[nH]c3sc(Cc4ccccc4)cc3c2=O)cn1 InChI=1S/C20H20N4OS2/c1-14-12-23(13-21-14)8-5-9-24-19(25)17-11-16(27-18(17)22-20(24)26)10-15-6-3-2-4-7-15/h2-4,6-7,11-13H,5,8-10H2,1H3,(H,22,26) RRSRUDDLOUTCMQ-UHFFFAOYSA-N 159373 US9034907, 26 Glutaminyl-peptide cyclotransferase Homo sapiens 616 5210 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159373 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159373&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594300 277285343 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302139 Cc1cn(CCCn2c(=S)[nH]c3ccsc3c2=O)cn1 InChI=1S/C13H14N4OS2/c1-9-7-16(8-14-9)4-2-5-17-12(18)11-10(3-6-20-11)15-13(17)19/h3,6-8H,2,4-5H2,1H3,(H,15,19) LZOLEZYSUGFKLF-UHFFFAOYSA-N 159374 US9034907, 27 Glutaminyl-peptide cyclotransferase Homo sapiens 348 2950 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159374 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159374&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594301 277285344 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302140 O=c1n(CCCn2ccnc2)c(=S)[nH]c2ccccc12 InChI=1S/C14H14N4OS/c19-13-11-4-1-2-5-12(11)16-14(20)18(13)8-3-7-17-9-6-15-10-17/h1-2,4-6,9-10H,3,7-8H2,(H,16,20) QDGPWKXRMZRCIT-UHFFFAOYSA-N 159375 US9034907, 28 Glutaminyl-peptide cyclotransferase Homo sapiens 300 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159375 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159375&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 78209037 277285345 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302141 Cc1csc2c1[nH]c(=S)n(CCCn1ccnc1)c2=O InChI=1S/C13H14N4OS2/c1-9-7-20-11-10(9)15-13(19)17(12(11)18)5-2-4-16-6-3-14-8-16/h3,6-8H,2,4-5H2,1H3,(H,15,19) PEIDWGXLRCWHPG-UHFFFAOYSA-N 159376 US9034907, 29 Glutaminyl-peptide cyclotransferase Homo sapiens 360 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159376 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159376&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594302 277285346 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302142 O=c1n(CCCn2ccnc2)c(=S)[nH]c2sc3CCCCc3c12 InChI=1S/C16H18N4OS2/c21-15-13-11-4-1-2-5-12(11)23-14(13)18-16(22)20(15)8-3-7-19-9-6-17-10-19/h6,9-10H,1-5,7-8H2,(H,18,22) LLNQGQJAFDUNEO-UHFFFAOYSA-N 159377 US9034907, 30 Glutaminyl-peptide cyclotransferase Homo sapiens 340 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159377 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159377&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594303 277285347 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302143 CCc1c(C)sc2[nH]c(=S)n(CCCn3ccnc3)c(=O)c12 InChI=1S/C15H18N4OS2/c1-3-11-10(2)22-13-12(11)14(20)19(15(21)17-13)7-4-6-18-8-5-16-9-18/h5,8-9H,3-4,6-7H2,1-2H3,(H,17,21) JTHRXQCJEJVKQE-UHFFFAOYSA-N 159378 US9034907, 33 Glutaminyl-peptide cyclotransferase Homo sapiens 1120 11040 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159378 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159378&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 78378264 277285348 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302144 O=c1n(CCCn2ccnc2)c(=S)[nH]c2sc3CCCc3c12 InChI=1S/C15H16N4OS2/c20-14-12-10-3-1-4-11(10)22-13(12)17-15(21)19(14)7-2-6-18-8-5-16-9-18/h5,8-9H,1-4,6-7H2,(H,17,21) MSBHQHBFHGRWJF-UHFFFAOYSA-N 159380 US9034907, 35 Glutaminyl-peptide cyclotransferase Homo sapiens 615 5850 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159380 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159380&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594304 277285349 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302145 O=c1n(CCCn2ccnc2)c(=S)[nH]c2sc3CCCCCCc3c12 InChI=1S/C18H22N4OS2/c23-17-15-13-6-3-1-2-4-7-14(13)25-16(15)20-18(24)22(17)10-5-9-21-11-8-19-12-21/h8,11-12H,1-7,9-10H2,(H,20,24) ILWHSGDWFAFTCD-UHFFFAOYSA-N 159383 US9034907, 38 Glutaminyl-peptide cyclotransferase Homo sapiens 900 7980 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159383 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159383&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 78314700 277285350 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302146 O=c1n(Cc2ccc3[nH]cnc3c2)c(=S)[nH]c2sc3CCCCc3c12 InChI=1S/C18H16N4OS2/c23-17-15-11-3-1-2-4-14(11)25-16(15)21-18(24)22(17)8-10-5-6-12-13(7-10)20-9-19-12/h5-7,9H,1-4,8H2,(H,19,20)(H,21,24) MMKIADIJDWMOMU-UHFFFAOYSA-N 159384 US9034907, 42 Glutaminyl-peptide cyclotransferase Homo sapiens 18700 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159384 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159384&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594305 277285351 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302147 O=c1n(-c2ccc3[nH]cnc3c2)c(=S)[nH]c2ccccc12 InChI=1S/C15H10N4OS/c20-14-10-3-1-2-4-11(10)18-15(21)19(14)9-5-6-12-13(7-9)17-8-16-12/h1-8H,(H,16,17)(H,18,21) FTKVZMFCGKCXLH-UHFFFAOYSA-N 159385 US9034907, 43 Glutaminyl-peptide cyclotransferase Homo sapiens 120800 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159385 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159385&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594306 277285352 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4 302148 Cc1csc2c1[nH]c(=S)n(-c1ccc3[nH]cnc3c1)c2=O InChI=1S/C14H10N4OS2/c1-7-5-21-12-11(7)17-14(20)18(13(12)19)8-2-3-9-10(4-8)16-6-15-9/h2-6H,1H3,(H,15,16)(H,17,20) KYTVAVQVUDVHPM-UHFFFAOYSA-N 159386 US9034907, 44 Glutaminyl-peptide cyclotransferase Homo sapiens 7420 36850 8.0000 30.00 C US Patent 10.7270/Q2V69HBJ aid1801246 US9034907 Buchholz, M; Heiser, U 5/19/2015 12/7/2015 Probiodrug http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=159386 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=986&target=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=159386&enzyme=Glutaminyl-peptide+cyclotransferase&column=ki&startPg=0&Increment=50&submit=Search 102594307 277285353 1 MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL 9ISD,8XGB,9KMB,9IVV,8XGY,8XGT,8HY3,3PBB,2AFZ,2AFX,2AFW,2AFO,2AFM,7CM0,6YJY,6YI1,3SI0 Glutaminyl-peptide cyclotransferase QPCT_HUMAN Q16769 Q16770 Q3KRG6 Q53TR4